KEGG   Phytophthora infestans: PITG_07546Help
Entry
PITG_07546        CDS       T01333                                 

Definition
replication protein A 32 kDa subunit, putative
Orthology
K10739  
replication factor A2
Organism
pif  Phytophthora infestans
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:pif03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:pif03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pif03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pif03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 259 aa AA seqDB search
MSSQPSGSQSTPTKRSGGAQSILPVTIKQLQSLNAGDDDAVRLDGQEVSTVRLVGLLTNL
TPQSTSLRFQLDDGSGAFDCQYFVNADEDASEGDLREGSYVRVVGKLRSFQGKASLSCFN
VVPVQDMNELTHHLLEVIYAHCYNTKGPLNDGKADVTMTSFNTPTKGANQWNQPNAGATG
GFGGGVDYGMMDSNFSPEQKAILDVLGTCTSDRGIKIDQIYADLNGQMNEQQLRSALNYL
TSEGHVYSTIDEDHFKRTA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccagccctcaggcagtcaatcgactcccactaagcgtagcggtggcgctcag
agcatcctcccagtgactatcaagcagctgcaatcgctaaacgcaggagacgatgacgcg
gtgcgtctggacggccaagaagtgtccacggtgcggctcgtggggctgctcaccaacctc
acgccgcaatctacgagcctgcgcttccaactagacgacggctctggagccttcgactgc
caatactttgtcaacgccgacgaagacgccagtgaaggcgacctgcgagagggcagctac
gtgcgtgtggtaggcaagctgcgctccttccagggcaaggccagtctctcctgcttcaat
gtagtgcccgtacaagacatgaacgagctgacgcatcatcttctggaggtgatctacgct
cactgctacaatacaaagggcccgctcaacgacggcaaggcggacgtcacgatgacgtcg
tttaacacgcctacaaagggagcgaaccagtggaaccagccgaatgctggcgccacggga
ggtttcggaggaggtgtggactacggtatgatggattccaacttctctcccgagcaaaag
gccattctggacgtcctgggcacgtgcaccagcgaccgcggcatcaagatcgaccagata
tacgccgacttgaacggacaaatgaatgagcagcaactgcgaagtgcactcaattatctc
actagtgagggacacgtgtactcgactattgacgaggaccacttcaagcgcacggcgtag

DBGET integrated database retrieval system