KEGG   Phytophthora infestans: PITG_07656Help
Entry
PITG_07656        CDS       T01333                                 

Definition
ubiquitin-specific protease, putative
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
pif  Phytophthora infestans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 901 aa AA seqDB search
MGKGKKKQSKKNHKRKQNGAPVPTSEDPVAPASNHSLNSNGSGKGGNPLSNDAAKRLDRN
KQRAIIKRLMTQADEQGLQMGDKRFVLSAKWWERWCEFVGYDDKQDIPATGAGNPAPSRI
NNLPLLHVGSDTSLDELMGGPLRPQLKENYHYVLLPQEVWDALLIWYSGGPTIARFVVQV
GDPELGNAFNRVQVYPEQPEDAEPEATTNGTKDSSMQKIDANGKNDDSADGAKLAVQRKP
AAVSCSIPKICGACRKPTGSLKRCGSCQLIWYCGANCQMSHWKYHKGVCRSTLTAEEKED
DILQGLQAERRGKMGLRNLGNTCFMNSALQCLSHVELLTRYFLSNRYKKDLNRDNPLGTG
GNLAEEYDGLLKELWFGTVPSTSPANLKRAISRFAPQFSGFQQHDAQELLAYIIDGLHED
LNRVKHKPYTEVNESDGSQDDAAVAKEAWQRHLLRNDSIFVDHVQGQFKSTVVCPICNKV
SITFDPFNCIQLELPQQQNRQIEVIFVPSESAKSMTRYLVDVPKKGSVLVLKRALSKLCG
VSPSSLLAADIYQSMTYRIIGDTERVHRFREDDRILMYQVDVKPTEEPVQYGFLYHRVGS
TLTGDPLLFTYTASTTCAEMLATWSELLNTHVSQSSSAKIPTNMLSQCVFLTDRDGILLR
NEPVPPAADSKFLDFATLHGEELPDELVFVSVAWSPSMLSSSASPRPDVERIVNHESMRA
KSSGSRGHDGISLDDCFRNFVKPETLDQANLWYCSKCNEHRQARKTMEMWRLPDVLVLSL
KRFEYRNEILRDKLDVYVDFPLEGLDMSPYCLEKSDDKDHLSYDLFAVSNHYGSMGFGHY
TAFAKSWQDEGEMYPGWYSFDDSLVAPAMPNQVKSNAAYILFYKRKNLQVEPTRSNKTKQ
S
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagggcaagaagaagcagtcaaagaaaaaccacaagcgcaagcagaacggggca
cccgtcccaacgtccgaggaccccgtagcgcccgcctccaaccacagtcttaatagtaac
gggtcaggaaagggtgggaatccactatctaacgatgcagccaagcgtctggaccgcaac
aagcagcgagcgatcatcaagcgtcttatgacgcaggcggatgaacaagggctgcagatg
ggggacaagcgctttgtgctctcagccaagtggtgggagcgctggtgtgaatttgtaggc
tatgacgacaagcaggacatacccgcgacaggggcaggtaaccctgcacccagccgtatc
aacaatcttcctctgcttcatgtcggctcggacacgtctctggatgagcttatgggtggc
cctctgcgaccacaactgaaggaaaactaccattacgtgctccttccgcaagaagtttgg
gatgcacttctcatttggtacagtggaggaccgaccatcgctcggtttgtcgtgcaggtc
ggagatccggagctaggcaacgctttcaaccgtgtgcaagtctatccggaacaacctgaa
gatgcagagcctgaggctacaacaaatggcacgaaagacagctcgatgcagaagatcgat
gcaaatggcaagaatgacgactcggcagatggagccaagcttgctgtacagcgtaaacct
gctgctgtatcgtgttcgatacccaaaatctgtggagcctgcaggaaacccacgggctcg
ctgaagcgatgtggaagttgccagttaatttggtactgcggtgcgaactgtcagatgtcg
cactggaagtatcacaagggcgtgtgccgctcgactcttacagcggaagagaaagaggac
gacattttgcagggcttgcaagcagaacgacgagggaaaatgggtcttcgcaacctggga
aacacgtgctttatgaactcggcactgcagtgtttgagtcacgtggagttgttgacgcgc
tatttcctgagcaatcggtacaagaaggacttgaatcgtgacaatccgttaggaacgggt
ggaaatctagccgaggagtacgacggtttactgaaggagctgtggttcggtactgtgccc
agcacgtcgcctgccaacttgaagcgagctatcagtcgctttgcgccgcagttctctggt
ttccagcagcatgatgcgcaagagttacttgcatatatcatcgatggcttgcatgaagat
ctcaatcgcgtcaagcacaaaccttatactgaagtgaacgagtcggacggctcgcaagac
gacgctgcggtcgcgaaggaagcgtggcaacgtcatctactgcgcaacgacagtatcttt
gtggatcatgttcagggccagttcaagtccacggtcgtgtgtccgatttgcaacaaggtg
tcgatcactttcgacccgtttaactgtatccagcttgagttacctcaacaacagaaccgc
cagattgaggtcattttcgtcccaagtgagtctgccaagtccatgacgcggtatctcgtc
gacgtgcccaagaagggaagtgttcttgtactgaaacgggcactgagcaaactgtgcggc
gtcagtcccagctccttgttggcggcagatatttaccagtccatgacctatcgcattatt
ggagataccgagcgagtacaccgatttcgagaagatgatcgcattctcatgtaccaggta
gacgtcaagccaaccgaagagcccgtgcagtatggatttctgtatcaccgagtggggtcc
actttgacaggcgatccgctgctcttcacgtacactgcgtcaactacttgtgcggagatg
ctggcaacgtggagcgaattgttgaatactcacgtatcgcagtcgtcgagtgcgaagatc
ccgaccaatatgctgtctcaatgcgtgtttcttacagaccgcgacggcatcttgttgcgc
aatgagcctgttcctccagctgccgactcgaagtttctggattttgccacgcttcacggt
gaggaattgccggacgagttagtgttcgtctcggtcgcctggtcaccatcgatgttgtca
tcgtcggcttctccccgaccggacgtcgagcggattgtcaatcacgagagtatgcgcgct
aagtcgagtggatctcgtggacacgacggtatttctctggacgattgtttccggaacttt
gtcaagccggagacgctcgaccaggccaatttgtggtactgtagcaagtgcaacgagcac
cgacaagcacgcaaaaccatggagatgtggcggctaccagacgtgctagtgctttcgctc
aagcggttcgagtatcgcaatgaaatcttgcgcgacaagttggatgtgtacgtggacttc
ccgctggagggtctagacatgtccccgtattgtctcgagaagagcgacgacaaggaccat
cttagctacgacctgttcgccgtgagcaatcactatggcagtatgggcttcggtcactac
accgcatttgccaagagctggcaggacgaaggcgagatgtatccgggctggtactcgttt
gacgacagtctggtggcgccagcgatgcccaaccaggtcaagtccaacgcagcatacatt
ttgttctacaaacgcaagaacctccaggtggagccaactcgtagtaacaagactaaacag
agttag

DBGET integrated database retrieval system