KEGG   Phytophthora infestans: PITG_08426Help
Entry
PITG_08426        CDS       T01333                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, putative
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
pif  Phytophthora infestans
Pathway
Metabolic pathways
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     PITG_08426
Glycosyltransferases [BR:pif01003]
 Glycan extension
  Type 3 chain
   PITG_08426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 343 aa AA seqDB search
MLLLLLALLAFPACSHRPDLLKELGDNVPAMELVNVSPLSSEAAKSRVLCWVNTYHANHD
KRLHAIKRTWGRKCDKLLFMSDIEDLSVPTVEIVAPPRHEMLWQKHREIVRLLVREYSED
QFDWVFKCDDDTFLIMENLKTYLNSPEIRAVAEDGPVLLGHRMTLQWWEMQRLFEPFENH
NPDRVAAMLKVKQDTKNDGGLLYTPGGGGYAMNWAYLKKLEAAFEEPFCLPNEVVPDDWA
ISFCMRQFGVIPLDTRDKEKRERFHQYDPNDLYTRPYDEEAYDHKLFSSIYQENNWFSDH
FGIGWQNGKNCCAPDSITFHYVKPPLMDLFYEYYYGQQNATKT
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgttgcttctcgctctgttggccttccccgcctgcagccaccgccccgatctc
ctcaaagaactgggtgacaatgtgccagccatggagctagtaaatgtctctccattatca
tcggaggctgccaagtctcgcgtcctctgctgggtgaacacgtaccacgccaaccacgac
aagcgacttcacgccatcaagcgaacatggggtcgcaagtgcgataagctgctgttcatg
agcgacatagaagacctgtcagttcctactgtggaaattgtagcccctccacggcacgag
atgctgtggcagaagcaccgcgagattgtgcggcttttggtccgcgaatacagcgaagac
caattcgactgggtctttaaatgcgacgacgacacctttttgatcatggagaacctcaag
acttatctcaatagtcccgaaattcgcgcagtcgccgaggatgggcccgttcttttgggt
catcggatgacgttgcagtggtgggaaatgcagcggctgttcgaaccttttgagaaccac
aatccggaccgtgtggcggcgatgctcaaggtgaaacaagacacgaagaatgacggaggt
ctactgtatacccctggaggaggagggtatgctatgaattgggcatacttaaagaaattg
gaggcggcgtttgaggaacctttttgtctgccgaacgaagtggtgccggatgattgggct
atttcgttttgcatgcggcaattcggtgtcattccgctggatacgcgggataaagagaag
agagagaggttccaccagtatgaccccaacgatctgtatacgagaccgtacgatgaagag
gcctacgatcacaaactcttctcgtcgatttaccaggagaacaattggttctcggatcac
ttcggcattggatggcaaaatgggaagaactgctgtgcaccggactcaattacctttcat
tatgtcaagccaccgttgatggatctgttttacgaatactattatggacaacagaacgcc
acgaagacttag

DBGET integrated database retrieval system