KEGG   Phytophthora infestans: PITG_08883Help
Entry
PITG_08883        CDS       T01333                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PITG_08883
Peptidases [BR:pif01002]
 Cysteine Peptidases
  Family C86
   PITG_08883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 153 aa AA seqDB search
MSEKEELYHERQTLYRCGLHALNNVLQGPVFSKASLDDACVELAALADPNAGSGFMNWVW
NPHRAPLGLGNYDVNALTLVLQQKGYVMQWIDKRQPVNENLFNLDEAEGVLCNVVMTTIL
SSLWTPRHWFAIRKIRGVCYNLDSKLEAPVVRC
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaggaggaactctatcacgaacgccagacgctgtaccgctgcggtcttcac
gcgctcaacaacgtattgcaaggccccgtattctccaaggcctcactagatgatgcttgc
gtagaactagcggcattagctgacccaaacgctggcagtggcttcatgaactgggtctgg
aaccctcacagagccccattggggctcggaaactacgacgttaacgctctgacccttgta
ttgcagcaaaaaggctacgtgatgcagtggatagataagcgacaaccagtgaatgagaac
ctgttcaacttggatgaagcggagggggttctgtgtaatgtggtgatgactacgatactc
agtagcctatggacgccgagacactggttcgccattcggaagattcgaggcgtttgctac
aatttggactcgaagcttgaagctccagtggtgcgttgttga

DBGET integrated database retrieval system