KEGG   Phytophthora infestans: PITG_08955Help
Entry
PITG_08955        CDS       T01333                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pif  Phytophthora infestans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pif00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 246 aa AA seqDB search
MAPITTTLSTAEHGLHPTDSFLVQASAAKSQGMQNTKEERLEQLSMTLPSRSPNDYVEDK
EKLEKMAAAVTTLLECIGEDPQREGLVKTPMRMAKALLYNTKGYGQSLSDVLNEAVFEED
HDEMVIVRDIDLYSMCEHHMVPFTGKVHIGYIPNGKVLGLSKLARVSEVFSRRLQVQERL
TKQIANAIMGVIEPKGVAVVIEATHMCMVMRGVEKSGASTVTSSVLGVFKSDPRTRSEFM
SLIHRR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcccccatcacaaccactctcagcactgccgagcacggcctgcaccccaccgactcg
ttcctagtgcaagccagcgctgcgaaatcccaaggaatgcagaacactaaggaagagcga
ctagagcagctctccatgacgcttccttcgcgttctcccaacgactacgttgaggacaag
gaaaagctcgagaagatggctgcagccgttaccacattgctcgaatgcatcggagaagat
ccacagcgcgagggtcttgtcaagacgcctatgcgtatggccaaggcattattgtacaac
accaagggctatggccagagcctcagtgatgtcttgaacgaggctgtattcgaggaagac
cacgacgaaatggtcattgtacgagatattgacctgtactccatgtgcgagcaccacatg
gtgccgttcacgggtaaagtgcacatcggatacatccctaatggcaaagtactgggcctc
agtaagctggcgagagtcagcgaggtcttctcgcgtcgtctgcaggtgcaggagcgtctg
acaaagcagatcgcgaatgccattatgggcgtcattgagcccaagggcgtggctgtcgtc
attgaggccacacacatgtgtatggtcatgcgtggcgtggagaaaagcggagccagtacc
gtcacgagctccgtacttggcgtgttcaagagcgacccacgcaccagaagcgagttcatg
tcgctcatccacaggagataa

DBGET integrated database retrieval system