KEGG   Phytophthora infestans: PITG_08955Help
Entry
PITG_08955        CDS       T01333                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pif  Phytophthora infestans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PITG_08955
Enzymes [BR:pif01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PITG_08955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 246 aa AA seqDB search
MAPITTTLSTAEHGLHPTDSFLVQASAAKSQGMQNTKEERLEQLSMTLPSRSPNDYVEDK
EKLEKMAAAVTTLLECIGEDPQREGLVKTPMRMAKALLYNTKGYGQSLSDVLNEAVFEED
HDEMVIVRDIDLYSMCEHHMVPFTGKVHIGYIPNGKVLGLSKLARVSEVFSRRLQVQERL
TKQIANAIMGVIEPKGVAVVIEATHMCMVMRGVEKSGASTVTSSVLGVFKSDPRTRSEFM
SLIHRR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcccccatcacaaccactctcagcactgccgagcacggcctgcaccccaccgactcg
ttcctagtgcaagccagcgctgcgaaatcccaaggaatgcagaacactaaggaagagcga
ctagagcagctctccatgacgcttccttcgcgttctcccaacgactacgttgaggacaag
gaaaagctcgagaagatggctgcagccgttaccacattgctcgaatgcatcggagaagat
ccacagcgcgagggtcttgtcaagacgcctatgcgtatggccaaggcattattgtacaac
accaagggctatggccagagcctcagtgatgtcttgaacgaggctgtattcgaggaagac
cacgacgaaatggtcattgtacgagatattgacctgtactccatgtgcgagcaccacatg
gtgccgttcacgggtaaagtgcacatcggatacatccctaatggcaaagtactgggcctc
agtaagctggcgagagtcagcgaggtcttctcgcgtcgtctgcaggtgcaggagcgtctg
acaaagcagatcgcgaatgccattatgggcgtcattgagcccaagggcgtggctgtcgtc
attgaggccacacacatgtgtatggtcatgcgtggcgtggagaaaagcggagccagtacc
gtcacgagctccgtacttggcgtgttcaagagcgacccacgcaccagaagcgagttcatg
tcgctcatccacaggagataa

DBGET integrated database retrieval system