KEGG   Phytophthora infestans: PITG_10031Help
Entry
PITG_10031        CDS       T01333                                 

Definition
lysosomal alpha-mannosidase, putative
Orthology
K01191  
alpha-mannosidase [EC:3.2.1.24]
Organism
pif  Phytophthora infestans
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PITG_10031
Enzymes [BR:pif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     PITG_10031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1023 aa AA seqDB search
MRVLGTLASALLAASAAATCDPSKWKPPSDGVYNTSSRVDPNKLNVHLIAHSHDDPGWLI
SVDQYYTQRVQYILDTAVEELVRNPDRQFMYVEQSFFQRWWHQQGSEVRGIVKQLVREGR
LDLTVNGGWCMHDEATPHYIAMVDQTAYGHQLLMDEFGISPRIGWQIDPFGHSATQGSLL
SQGVGFDALYFARIDYQDYGNRKKNKDLEFIWRPSKSRGKASQVFTGEIIDHYCPPGKFD
FGNNGNQIQDDPELHDYDVCDEVEQFVSNAKMRGDHSKGNHVFIPMGCDFQYDNSLRWFK
NMDKILHYVNQDGRVNVLYSNLSYYTDVKREEGLTWSVKTDDFFPYGSAQDDYWSGFFTS
RPTLKRFARVANTLLQQVRQIDAVYQSHHSSPLVALQRAVGLVQHHDGVSGTEKQSVADD
YSLRLNDGIIKAEKELNEVLFVIGDKEPYHLCLLANTSVCDVSTQNSNFEVLVHNALART
SVQTFSIPITHKSAEVTLLSGNAKVREQNVYVALPVHPEVQVAPYSFVFSAELKPLSTTR
FTVKQKDIEAEEIVTDSLDATDDVIVLENHLMRAEISKTTGSITKLANKKKNIQIPLSLD
VAYYQAFQAGGPKSGAYVFRPDSNKTYPVAGKENSLLDVEMVELHTAANGGLASVPRVAF
KIGSWVTLEYRVNDNDEFLEIEWTVGPVPIDDKTGKEVILRFDAGKSIASDATLYTDSNG
LEFMKRVRNHRDTWNLTLHDNQEAVAANYFPITTGAYIKDETHQLNVVTDRAQGAASLVD
GQVEVMVHRRLLADDNKGVSEHLNETESVYDSATKKQVTKGLVVRGNFFVNVDSAEDGMR
SIRSKMEAQFFRPLTIFRKPVPSEVEAKVPWLTVNDFPENVGLTTLQELTKQCLMVRLSH
LYAVDEHSTLSKPVTVDFSTLFSVKNAAVSEVKELVLTGTKELAEQQEGTGMQWKTTDDA
YGWTPRSLPVKGTSVTLQAIEVRAFRVCFAKSAAAAVDGPEEDGYSESLDAVLQDLAEVI
AFE
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgctaggaacgctcgcatcagctctactagctgcgagtgcggccgctacctgc
gacccgagcaagtggaagcctccctcggacggcgtgtacaacacatcaagtcgcgtggac
ccaaacaaactcaacgttcacctcattgcgcactctcatgacgatcctggctggctcatc
agcgtggaccagtactatacccaaagagtgcagtacatcctggatacggccgtggaagag
ctcgtgcgcaacccggaccgccagttcatgtacgtggagcaatcattctttcaacgttgg
tggcatcaacaaggatccgaggtgcgcggcatcgtcaagcaactcgtacgcgaaggccgc
ttagacctgacggtcaatggcggctggtgcatgcacgacgaggccacaccgcactatatc
gccatggtggaccagaccgcgtacggccatcagctgctcatggacgaattcggcatcagt
ccgcgtatcggttggcagatcgacccgttcggccactcggccacgcaaggttcgctgttg
tcgcaaggtgtgggcttcgatgcgctgtacttcgctcgtatcgactaccaggactacgga
aaccggaagaagaacaaggatctcgagtttatctggcgtcccagcaagtctcgtggcaag
gcgtcgcaagtgttcactggagagatcattgaccactactgtccacctgggaagtttgac
tttggcaataacggcaaccagatccaagacgacccggagctgcacgactatgacgtgtgt
gacgaagtggaacagttcgtcagcaatgccaagatgcgcggcgaccattcgaaaggcaac
cacgtctttatccccatgggctgcgacttccagtacgacaattcgcttcgttggttcaag
aacatggacaagatccttcactatgtgaaccaggacggccgagtgaatgtactgtactcc
aacttgtcgtattacacggacgtgaagcgagaagaaggactgacgtggagtgtcaagacc
gacgactttttcccgtatggatcggctcaagacgattactggtccggtttcttcaccagt
cgaccgacgttgaagcggttcgcacgtgtggcgaacactctactgcagcaagtgcgacag
attgacgccgtgtatcaaagccaccactcgtctccgttagttgcattgcagcgtgctgtg
gggctcgttcagcaccacgacggtgtctctggaacggagaagcagagtgttgctgacgac
tattcgctgcgtttaaatgacggcatcatcaaggcggagaaggagctgaacgaggtcttg
ttcgtgattggagacaaagagccctaccacttgtgtctgctagccaacacgagtgtgtgc
gacgtgtccacccagaactccaactttgaagttctggtgcacaatgcactggcgcgtaca
agtgtgcagacgttctcgatcccgatcacacacaagtcggcagaggtgacgctgctctcg
ggtaacgccaaagtccgtgaacagaacgtctatgtggcgctgccagtgcatcctgaagtg
caggtggctccgtactcgttcgtgttcagtgcagagctcaagccgttgagcacaacgcgg
ttcacggtcaagcagaaggatattgaagctgaagagatcgttactgacagtctggatgct
accgacgacgtgattgtgctggagaaccacctgatgcgagcggagatcagcaagaccacg
ggctccatcacgaagctcgccaacaagaagaagaacattcagatcccgctttctcttgac
gtcgcgtactaccaggcgttccaagctggcggacctaagtctggggcgtatgtgttccgt
cccgactcgaacaaaacataccccgttgcgggcaaagagaactcgctactagacgtggag
atggtggagcttcacacggccgcgaacggtggtctagccagtgtgccgcgtgtggctttc
aagattggtagctgggtcacgctcgagtaccgtgtgaacgacaacgacgagttcctggag
atcgagtggacggtcggacctgtccccattgacgacaagacgggcaaggaggtgattctg
cgcttcgacgccggcaagagcatcgcatctgacgctacgctgtacacggattcgaacgga
ctcgagttcatgaagcgtgtgcgcaaccaccgcgacacgtggaacttgacgttgcacgac
aaccaggaggcggtggcggccaactacttccccatcacgacgggagcgtacatcaaggac
gagacgcaccagttgaacgtcgtgacggatcgtgcgcaaggagcagcgagtctggtggat
ggccaggtggaggtgatggttcatcgtcgtctgctggctgacgacaacaaaggagtgagt
gaacacttgaacgagacggagtctgtgtacgactcggctacgaagaagcaagtgacgaag
ggtctggtggttcgcggcaacttcttcgtcaacgtggactcggctgaggacggcatgcgc
agtatccgctccaagatggaggctcagttcttccgtccactgacgatattccgcaaacca
gtaccgtcggaagtggaagcgaaggtgccgtggcttacggtgaatgactttcctgagaac
gtgggtttgacgacgctacaggagctgacgaagcagtgtttgatggtgcgtctgtcgcac
ttgtacgctgtggacgagcactcgacgttgtcgaagcctgtgacggtggacttctcgact
ttgttctctgtgaagaacgcggccgtgtcggaggtgaaggagctggtgctgacaggcacc
aaggagctggctgagcagcaggaggggaccggtatgcagtggaaaaccacggacgacgcg
tacggatggactcctcgttcgctgccggtgaagggcacgtcggtgacgctgcaggcgatc
gaagtgcgagcgttccgcgtgtgcttcgccaagtctgctgctgctgctgtcgacgggccg
gaagaggatggctacagtgagtcacttgatgcagtgctccaggatctggcggaagtcatc
gcgtttgagtaa

DBGET integrated database retrieval system