KEGG   Phytophthora infestans: PITG_10080Help
Entry
PITG_10080        CDS       T01333                                 

Definition
uroporphyrinogen-III synthase, putative
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pif  Phytophthora infestans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PITG_10080
Enzymes [BR:pif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PITG_10080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 268 aa AA seqDB search
MSASVLLLKAADEKYRAAIEQDPEPGCSRRLLEAYFTDVLTFEYLNAELLLDVLTHLDRY
CGIMITSPRSAIAVCNVVNTLDAELKLQILDKLRAKPVFSVGEATSRELLPLGVVCKGDD
AGSADLLSAYLHQDGILPADCKEKPMLFLCGDKRRDVLPDSFRSRGLPMEELVVYQTCAV
QTLELPAECMVPSWIVFFSPSGLKVIKELALPWESIRKAAIGKTTAAALHEHALATGQTF
WEADVTAPKPKPDSLAGAIFAFEEEYKQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgtcggtgctgctgctcaaggcagcagatgaaaagtacagggccgctatagaa
caggacccagaaccgggatgttctcgacggctattggaggcatacttcacagatgtgttg
acgttcgagtacctcaatgccgagctgctacttgacgtgttgactcacctcgatcgatac
tgcggaatcatgatcactagcccacgcagcgcaattgctgtgtgtaacgtagtcaacacg
ttggacgcggagctgaagctgcagatactggacaaactgcgagctaagcctgtgttctct
gtgggtgaagccacgtcacgtgagctgctgccgcttggagtggtgtgcaagggcgacgac
gccggctcggccgatttgctgtctgcgtacttacaccaagacggcatcttacctgcagat
tgcaaggagaagccaatgctgtttctttgtggcgacaaacgccgcgatgttctccccgac
agcttccgttcgcgcggtcttccgatggaagagctggtggtgtatcaaacatgcgctgtg
cagacacttgagctccctgcagagtgcatggtgccgagctggatcgtattcttcagtccg
agcggactgaaagtaatcaaggagctagctttgccttgggagtctattcgcaaggcagcg
atcggaaagacaacagctgcagccctgcacgagcacgcattagctacaggacaaacattc
tgggaagcagacgtaactgcgcccaagcccaagcccgactctctcgccggcgccatcttt
gccttcgaagaagaatacaagcagtga

DBGET integrated database retrieval system