KEGG   Phytophthora infestans: PITG_10160Help
Entry
PITG_10160        CDS       T01333                                 

Definition
NADPH-cytochrome P450 reductase, putative
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PITG_10160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 673 aa AA seqDB search
MTDSYVVVGSLLAMLATAVLFLREPKPKKDKLAEEMLRIGQQMKIPAYPGGRVAILFGSQ
TGTAEGFAEVLKAEGRKAGFQTHAIDLEDYDAASKLKDEKLVIFIMATYGEGDPTDNAVD
FIDFLKDKAGNLEPKTFDSVHFTVFGLGNTQYEHYNEMGRMTDRFMEKYGAERVFHYGEG
DDDASLDEDFDDWKEPLWRALRKQFIAGNSEEDTEVKQDEHKLTPPEYEYELVEIRKKQV
ENAPKEVKMKASTKHFFTANQAKVVVNRELRLSTAGGSTVHVELDLRGTGVTYETADNLA
VLPENETRVVESLATRLDLDLDQWVALKPVAEDLHCELPFPSPSTIEDILTRYLAINSAP
RKGPLKQLAYFAKNQAERDELVRLSSKEGKDAYQKWVLEDERSFVDVLTHFRSVNLTVKD
LLHIVPFLQPRYYTIASSSLVNPQRVHATVSLIESTKSDGRVFRGVCSNYLGRLQPLESH
TDDKKKRDSRPGEQGAKKPREWPTARIFMRASTFRLPASPLTPIILIGPGTGIAPMRAFL
HERAQQQQDGETVGQSIMYFGCRRRDEDFIYKNELESFQNSGVLSELHLAFSREQEKKVY
VQHLLLQNGLKTWELIRDHDAYIYVCGATGMGNDVNKVLHEIIEKYGGLSSDEAMATLKK
LQDDHRYIQELWA
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgacagactcgtacgtggtcgtaggctccttgctggccatgctggccaccgccgtgctg
ttcctgcgggagcctaagcctaagaaggacaaactggccgaggagatgctgcgtatcggc
cagcagatgaaaattcccgcctaccctggcggtcgtgtagccatcttattcggctctcaa
actggcactgccgagggcttcgctgaggtcctgaaggcagagggacgtaaagctggcttc
cagacccacgctatcgatctggaggactacgacgcggcctccaagctgaaagacgagaag
ctggtcatcttcatcatggctacatatggtgaaggtgatccgactgacaatgccgtggat
tttatcgattttcttaaggataaagcgggaaatctggagccgaagacgttcgacagcgtc
cactttactgtctttggcctcggtaacacccagtacgagcactataacgagatgggacgc
atgactgataggtttatggaaaagtatggagccgagagagtgttccactatggagagggc
gatgatgacgccagtttggacgaagactttgacgactggaaggagccactgtggagagct
ctgaggaagcagtttatcgcgggaaacagtgaggaagataccgaagtgaagcaggacgag
cacaagctgacgcctcctgagtacgagtacgaactggtggaaatccgcaagaaacaagtg
gaaaatgcacccaaagaggtcaaaatgaaggcgtcgaccaagcatttcttcacggccaac
caggcgaaagttgtggtgaaccgagagctgcgtctgtcgactgcgggaggctccacggtg
catgtggaactggatcttcgaggcactggagtgacctacgagacggccgataaccttgcc
gtcctgcctgagaatgagacgagagtcgtcgagagtctagcgactcgtctggacttggat
ttggaccaatgggtggctctcaagcctgtggctgaagatctccactgcgagctcccgttc
ccgtctccaagcacgatcgaagacattctaacacgttatctggcaattaacagcgctcca
cgtaagggcccattgaaacaactggcgtattttgcaaagaaccaagcggaacgtgacgag
ctggtgcgtttatcgtcgaaagaaggcaaagacgcgtaccagaagtgggtactggaagac
gaacgctcgtttgtcgacgtgttaacccacttccgatcagttaacttaacggttaaggat
ctgcttcacatcgtcccgttcttacagccacggtactacaccatcgcgtcgtccagtctg
gtgaacccgcagcgtgtccacgctactgtgagtctcattgagagtacgaagagtgatggt
cgtgtgttccgaggggtgtgttccaactacttggggcgtttgcagcctcttgagagtcat
acagatgacaagaagaagcgagacagtcgtccaggtgaacaaggagccaagaagccgcgt
gagtggcctacagcgcgcatcttcatgcgcgcgtcgaccttccgtctgcctgccagccct
ttgacgcctatcattctcatcggcccgggcacgggcatcgcccccatgcgtgcgttcctg
cacgaacgtgcccagcagcaacaagacggcgagactgtgggccaatccatcatgtatttc
ggctgtcgacgtcgtgacgaggactttatttacaaaaatgagctcgagagtttccagaat
tccggtgtgctcagtgaactgcacttggcgttctcgcgggagcaggagaagaaggtttat
gtgcagcatttgttgctgcagaacggactcaagacgtgggaacttattcgcgaccatgac
gcgtacatctacgtgtgtggagccacagggatgggcaacgatgtgaacaaggtgctgcac
gagatcatcgagaagtacggcggtctgtcctccgatgaggcgatggctacacttaagaaa
ctccaggatgaccaccgctacatccaggaactgtgggcatag

DBGET integrated database retrieval system