KEGG   Phytophthora infestans: PITG_10195Help
Entry
PITG_10195        CDS       T01333                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pif  Phytophthora infestans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pif01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pif01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 317 aa AA seqDB search
MMSVSQFKKEANWFMVYYLSVVHLGALEGLRRLFSCKWEMFPLFVFIYYLTGLGITMGAH
RLWAHRSYKAHGIVRFFLMLCNCMANQGTIFHWSRDHRVHHKYSDTVADPHDSGRGFFFA
HMGWLLVKKDPRVLEAGTKLNYDDLWADWTVVMQEKLNPWGNLFMCFVFPTIVGVQAIGE
DWKNALFVLGFLRYVAVLHATWLVNSAAHFYGYQTYDNIPPRENWFVSLWAIGEGWHNWH
HKFPYDYATSEFGATAQFNPTKLTIDFMALLGLVTDRKRATEIWSKIKESKEKGSKFQDP
NGDDPNQAFSELKAKAN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgtatcgcagttcaagaaagaggccaactggttcatggtctactacctgtcg
gtggtccacctcggagcactcgaaggtttacgtcgtctcttctcctgcaaatgggaaatg
ttcccattattcgtcttcatctactacctgacgggtctgggcatcacaatgggcgctcat
cgtctatgggcgcaccgcagctacaaggcgcacggcatcgtgcgcttcttcctcatgctc
tgcaactgtatggccaaccagggcaccattttccactggagtcgtgaccaccgtgtgcac
cacaaatactcggacacggtggcggacccgcacgactctggtcgtggcttcttcttcgct
cacatgggctggttgcttgtcaagaaagacccgcgtgtgctggaggccggtactaagctc
aactatgacgatctgtgggctgactggaccgtcgtgatgcaggagaagctcaacccgtgg
ggcaatttatttatgtgcttcgtcttccccacgatcgtgggcgtacaagccatcggcgag
gactggaaaaacgcgcttttcgtccttggtttcctgcgctatgtggctgtacttcacgcg
acgtggctcgtcaacagcgccgctcatttctatggctaccagacctatgacaacattccc
ccgcgtgagaactggttcgtgtcgctctgggctattggcgaaggctggcacaactggcac
cacaagttcccgtacgactacgccacaagcgagttcggcgccacggcacagttcaaccct
actaagcttacgatcgacttcatggcccttctgggtcttgtcacggaccgcaagcgtgcc
actgagatctggtcaaagatcaaggaatccaaggaaaagggctccaagttccaggatccc
aatggagacgaccccaaccaggctttctccgaactcaaggccaaagccaattaa

DBGET integrated database retrieval system