KEGG   Phytophthora infestans: PITG_10821Help
Entry
PITG_10821        CDS       T01333                                 

Definition
ubiquitin-specific protease, putative
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PITG_10821
Peptidases [BR:pif01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PITG_10821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 470 aa AA seqDB search
MAVPGLQNLGNTCFFNAILQALASLPSVHEFLEEIDRRARVERRRIAFTGALRDCLEALA
PRDTPVVVAPRILNAELTSKLRAFRGNKQQDAQELLQFLFKLVGGEQRRCGVQDRGLVDL
NPRDDVPTSDSISDLRLTQAVNERSWNPLQGLQVNLLQCARCRRFRPLNNQPFLDVSLSI
VAPGDKKVSRLMDALKLYTEAEVIKDVECSYCSVVDELEVTRKEYTQTIKGQRKNKLGMS
DRDVVEQELAQHELKGWIHTLEQLANSSTSFDLEQLERPIPRSRGDCFKRLQFSRSPDVF
CFHLNRKVYMRTGGAVKLETYVEFPLELDMDDYCQYKTSAGAESKGSNGSTSIRRPRASI
SSFVGETLKQQYLLYDLTAVILHHGNERCGHFTAYRRASPSQWFFVSDDNVREASVAEVL
KSCAYMLFYERKYRTKRTTRSSETEETTDDDDSLPDVPFEPHVLLPNGRF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcctgggctgcagaacctgggcaatacgtgcttcttcaacgccatcctgcag
gcgctagcgtcgctcccgagtgtgcacgaatttctcgaagagatcgaccgacgtgcacgc
gtcgaacgtcgtcgcatcgcgttcaccggcgcactacgcgactgtctggaggctctggcg
cctcgtgacacgccggttgtagtggctccccgcattttgaacgcggaactgaccagcaaa
ttgcgcgctttccgcggtaacaagcagcaggacgctcaggagctcctgcagttcctcttt
aagctcgtagggggtgaacaacgccgctgtggagtacaggaccgcggcctcgtggacttg
aatccccgagatgatgtgcccacatccgactctatcagcgacctacgactcactcaggct
gtaaacgaacgcagctggaacccactgcaaggccttcaggtcaatttactgcagtgcgca
aggtgccgtcgcttccgtccgctcaataatcagccattcctggacgtatcattgtcgatt
gtggctccgggggacaagaaggtctcacgtctgatggatgcactaaagctgtacacagag
gcggaggttataaaagacgtcgagtgcagctactgcagtgtggtggacgaactggaagtt
acaaggaaggagtatacacagactatcaagggacagaggaagaacaagttgggcatgagc
gacagagacgtcgtggagcaggagctcgcgcagcatgaactcaagggctggatccacaca
ctcgagcagctggccaactcgtccacgagcttcgacttggagcaactcgagcgcccgatc
cctcgcagccgtggcgactgcttcaagcggctgcagttttctcgcagtccggacgtcttt
tgtttccacttgaatcggaaagtttacatgaggactgggggagcagtcaagctcgagacg
tatgtcgagttccctttggagctcgatatggacgactattgccagtacaagaccagtgct
ggcgcagagtcaaaaggaagcaacggatcgacttccatacggcgacctcgagcatcgatt
tcctcttttgttggtgaaaccctaaagcagcagtatcttctatatgacttgactgccgtc
atcctccatcacggtaatgagcgctgtggccacttcacggcttatcgtcgcgccagtccc
tcgcagtggttcttcgtgtcggatgacaatgtacgcgaagcctcagtggccgaagttctc
aaaagctgtgcgtacatgcttttctacgaacgcaaatatcgcaccaagcggacaacacgc
agctccgagacggaagagacgaccgatgacgatgacagtctgccggatgtcccgttcgag
cctcacgtgctgctaccaaatggtcgtttctga

DBGET integrated database retrieval system