KEGG   Phytophthora infestans: PITG_11102Help
Entry
PITG_11102        CDS       T01333                                 

Definition
cGMP-dependent protein kinase, putative
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
pif  Phytophthora infestans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 810 aa AA seqDB search
MDFSKRMKDLILPPAPPSIKPSANSSAAATTTTVQLAPPALNVLDLNEHKGVRRAPIKED
AVEPGDLDSAQHVRVPKNNQTRAMITKALKAHYLFSSLDQGEIDEMIDVMAMVTIQAGEP
VIAQGTSGKCFYVLESGNCDIVVDGKLVGTYTNGDAFGELALLYNCPRAATIRATTGCIL
WTVERTTFRKIMATTASATQLARVNFLKNVELLQRLSNNQLQKVAAALKLQRFNDGDYII
RQGDDGNTFYIIVEGTVRCTSRMSGNDEAEKELMTLQRGNYFGEMALVLNEPRQANCIAV
GAVDCYVMDRAEFTKLLGPLRSLIDRQMRIRVLRSVPLLSSLTDDELDILAHALNVVAFE
DKSTIIKEGDDADTFYMISDGKVSVRKSGFEIMQLRSGEFFGERALLANEPRAADCVAVG
RVECLTLQRAAFEQLLGKLDHIMQREMQRQQLVQQSVMGGRTDVRADTATPIVPPAKKIL
YKDLDKIRTIGTGTFGRVIIVRHRPTNQAFALKCMSKAQIVETHQQKNVMYEKGILAECD
HPLILKLHETYQDANQLYMLFELVQGGELWSLLYEKAYKVAKGVCGAFDVSAARFYAANV
VEALRYLQKMTVAYRDLKPENLVIDSAGYLKMVDFGFAKHVPYYRNGALYERSFTLCGTP
EYLAPELVLNKGHGKAVDHWALGCLLYELIAGRTPFQHNDQNKIFEKILQGRAMVKFPSK
FDPDAKDLVMKLLETNPALRIGSLAGGMQDVVNHPFFTNAKFDWAAMVKKTLKDPYTPAI
KDAFDAGNFDAYPEDTKIRTFTGSDTFEGF
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggacttctcgaagcgtatgaaggatttgattcttccgccggcacctccgagcattaaa
ccgagtgccaactccagcgctgctgccaccactacgacggtgcagttggctcctccggct
ttgaatgtgctggacctgaatgaacacaaaggtgttcgacgcgctcccatcaaggaagac
gctgtagagccgggtgaccttgacagcgctcagcatgtccgcgttcccaaaaacaaccaa
acccgtgccatgatcaccaaagccctgaaagcccactacctcttcagctcactggaccaa
ggtgagattgacgagatgattgacgtcatggccatggtcaccattcaagctggggaaccg
gtcatcgcacagggcacgtcgggcaagtgcttctatgtgctggagagcggcaactgtgac
atcgtggtcgacggcaaactggtgggtacctacacgaacggcgatgcgttcggtgagctt
gcgttgctctacaattgtcctcgagctgctacgatccgtgccactacggggtgtattctt
tggacggtggagcgcactacgttccgcaagatcatggctaccacggcttcggccacgcaa
ctcgctcgcgtcaacttcctcaagaacgtggagctactgcaacgtctaagcaacaaccaa
ctgcaaaaagtggcggcggcactcaagctgcagcggtttaacgacggcgattacattatt
cgtcagggtgacgacggcaacaccttttacatcatcgtcgagggtaccgtacgctgtaca
tctcgaatgagtggaaatgatgaagccgagaaggagcttatgacacttcaacgcggcaac
tacttcggtgagatggctctcgtgctgaatgagccacgtcaagcgaactgcattgccgtg
ggcgctgtggactgctatgtcatggaccgtgcggaattcaccaagctgcttggcccgctt
cgatctttaatcgatcgtcagatgcgcatccgtgtcctgcgtagcgtgccgctgttgtct
tctctgaccgacgatgaactcgacatcctcgcgcatgctctcaacgtcgtggcattcgag
gacaagagtactattatcaaggaaggtgatgatgccgataccttctacatgatatcggac
ggtaaggtgagcgtccgcaagtccggattcgagatcatgcagctccgttcaggcgagttc
ttcggtgagcgtgctcttctcgctaacgaaccacgtgccgccgactgcgttgctgtcggt
cgtgtggaatgcctcacccttcagcgtgcagcttttgagcagcttcttggcaagcttgac
cacatcatgcagcgtgagatgcaacgccaacagctcgtccagcagtccgttatgggtgga
cgcactgacgttcgcgcggacactgcaaccccgatagtaccgccggccaaaaagatcttg
tacaaggacctggacaagatccgcaccattggtacaggaactttcggacgtgtgataatt
gtgcgtcaccgtcctacgaaccaggcttttgctctaaaatgcatgtcgaaagctcagatc
gtcgagacgcaccaacagaagaacgtcatgtacgagaaaggaatcctcgccgaatgcgac
cacccgctcatcctcaagctgcacgaaacgtaccaagacgccaaccaactctacatgctg
tttgagctcgtacagggcggtgaactttggagtctactctatgagaaggcttacaaggtc
gctaagggtgtctgtggcgcgttcgacgtctcagccgcaaggttctacgctgcgaacgtg
gttgaggctctccgctatctccagaagatgacggtcgcctaccgtgacttgaaacctgag
aacctggttatcgacagcgccggatacctcaagatggtcgactttggctttgccaagcac
gtgccgtactaccgcaatggtgcgttgtacgaacgctccttcactctttgtggtaccccg
gagtatctcgcccccgagcttgtgttaaacaaaggccacggcaaggcagtggaccactgg
gcgcttggctgtctgctgtacgagctcattgccggtcgcactccattccagcacaatgac
cagaacaagatcttcgagaagatcctccagggtcgcgctatggtcaagttcccgtccaag
tttgatcccgatgccaaagacttggtcatgaagctgctggagacgaacccagcactgcgt
atcggctcactggctggaggtatgcaggacgtggtgaaccacccgttcttcacgaacgcc
aagttcgactgggctgccatggtcaagaaaactttgaaagatccgtacacacccgcgatc
aaggacgcgttcgatgctggcaacttcgatgcctacccggaggacacgaagattcgaaca
ttcacaggcagcgacacctttgaaggcttttaa

DBGET integrated database retrieval system