KEGG   Phytophthora infestans: PITG_11273Help
Entry
PITG_11273        CDS       T01333                                 

Definition
ubiquitin-specific protease, putative
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PITG_11273
Peptidases [BR:pif01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PITG_11273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1331 aa AA seqDB search
MVEKRRSPVGDSPPEAQRRKKLNTRTDADVEPMDVDTPDAALPTLVFRETFPVLGLGNER
VVTPSQKDAQGASWRVIWQPRSLTDDSFVGVFVELVEQDSGAVRVAELSITLLNQGAQPA
LVKHTSVHEFTAENADFGMSQFVQRSELMNPSNQFLDKQGRVELELRLSFVGDSTQQLIS
YDSKEETGMVGLKNQGATCYLNSLLQTLFHLRAFRQVVYATPTAQEDTNDSVSLALQRVF
YRLQRQQKAVSTKELTRSFGWSAIDSFMQHDVQELYRILCDRLEEKMKNTPVDSAIQKLF
EGKVRSFVECVNVQFQSSREERFYDLQLDVKGCKNLMQSFRRYVEVEMLDGDNQYEAEGH
GKQDAKKGIEFLTFPPVLNIQLKRFEYDAMRDGMVKVHDRFEFPKTLVLDEFISKDKTKT
DAQSPSFIYHLHSVLVHSGDVHGGHYYVFIRPGKHIAASTDWFRFDDDQITRVDEQVAVE
GNFGSGGAVVTPPHGSTEPPSPLYSSSLFCSPERSNGANTEANGVDGLEFRSVDTGENTV
EETYDYSQNNGSGSLILNASSNSLMLPLGRSFSSAYMLVYVRDGENDVSAIQDATSDEEQ
YELPSWQSDPLPIPQELVTRFHEEEQAVARRKKAQQTEHLYMNLRIASDSSIAKLKRVTK
TLDFSGFNNSTTVRVRIKRAASIRQLYRRVYKETGVPMSRQRLWKVITRENRTTRPDLPL
GPDVYESCVDSLIEDDASPKTPVKMYLQILDATSEAALSPASPSSPSIHDVRDKKTRTAA
IHRHFLDEFSPPETKDEAKPSQELDEDDAVLHESTDSVVEHAPPLQSHDILLIIKFYDLK
KKLGERLEYVGNVVVDSRLTGAQLADYLHEALAIPSSRRILLFEEVQPVTVSTICLETPL
ATAEIQNGDIICFQYAEDEEPVDDIVLKPDPEDNPDAVETYIGPDGQERRSYPDVRSYFR
YLLDRVEVTFYRYGHSDEFFTLQLLLSNLYIEVIDAVAAHLDLIGPKRLFVRLYQHSPLN
NLPMKAPLRHSRYAADDQTTLDDLLTEYMERTNILHYELLEHPITEIEAKKELLVHLSIY
DACFATEQAASPSPVAPHRSVEVLVLPTHKVCDLLKLIRGGFGLPKDTPLRACEVVQHGT
MIRRVIKEDAELKRYWGTGHGADANTPEILVEQIPIDELSDEISETLSKDNMSDDERPLW
FYRGVVHFNFQNNANKWIHPHGVPCIVRFSEQETVGEVKERIRQRMGIASDVFAQWKFAL
VKDLKASTLQAVYDDMEAEALDAFPMSRLTELCGADFENLGNLGLEHADPTPPPRHHSNR
RQETGIHIRQS
NT seq 3996 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaagcgtcggagtccggtgggcgactcgccgcccgaggcccagcgccgcaag
aagctcaacacgcggaccgacgccgatgtggagcccatggacgtagacactccggacgca
gcgctgccaacgctagtttttcgcgaaacgtttcctgttctagggctgggcaacgagcgt
gtcgtgacgccctctcaaaaagacgctcagggcgcttcctggcgcgttatttggcagccc
agaagcctcaccgacgactctttcgtcggcgtgttcgtggagctcgtcgaacaagactca
ggagccgtcagagtggcagaactgagtatcacactgttgaatcaaggtgcacagcctgcg
cttgtgaaacacacgagcgtgcacgagtttaccgcggaaaacgccgactttggcatgagt
cagttcgttcagaggagtgaattgatgaacccgagcaatcaattcctggacaaacaaggc
cgcgtggaactcgagctgcgtctgagcttcgtaggcgactctacccagcaattgatatcc
tacgactccaaggaggagactgggatggtaggactgaagaaccagggagccacgtgttac
ctgaactcgctactacagacgctcttccacttgcgagccttccgacaggtcgtgtacgcc
acaccaaccgcccaggaagacacgaacgactcggtgtcgctggcgttacagcgcgtgttt
tacaggctacagagacagcagaaggccgtgtctaccaaggagttaacgcgctcttttggc
tggagcgcgatcgactcgttcatgcagcatgacgtgcaggaattgtaccggattctgtgc
gatcgattggaggaaaagatgaagaacacgcccgtggactctgcgatccagaagctgttc
gagggcaaagtcaggtctttcgtcgagtgtgtgaacgtacagttccagtcgagtagagag
gagcggttctacgacttgcagctggatgtgaaaggctgcaagaacttaatgcagtcgttc
cgcagatatgtcgaggtggaaatgctggatggagacaaccagtacgaagccgaaggacac
ggcaagcaggacgcgaagaaaggcatcgagttcttaacattcccgccggttcttaacatc
cagttaaaacgcttcgaatacgacgccatgcgcgacgggatggttaaggtgcacgaccgc
ttcgagttcccaaagacgctggtattggatgaatttatctcgaaggacaagacgaagacc
gacgcgcagtctccaagctttatttatcatctgcatagtgtgttagtgcacagcggcgac
gtgcatggcggtcattactacgtatttattcgaccgggcaagcacatcgcggctagtacc
gactggttccgcttcgacgacgaccagatcacgcgcgtggacgaacaagtggcggtcgag
ggcaattttggctctggaggagcggttgtgacgccaccgcacggctctacagagcccccg
tcgcctctgtattcgtcgtcactcttttgctcaccagagcgcagtaacggagcgaatacc
gaggcgaacggagtggacggactcgagttccgatcggtggatacaggcgagaatacagtc
gaagagacgtacgattacagccagaataacggtagtggcagtctcattttaaacgcgtcg
tcaaacagtctgatgctgccacttggtaggagtttttccagcgcgtatatgctggtatac
gtgcgtgacggcgagaacgacgtcagtgcgattcaagacgcaacaagtgacgaagaacag
tatgagctcccgagctggcaaagtgacccgctcccgatcccgcaagagcttgtgactcgc
ttccacgaagaggaacaggcagttgctagacgcaagaaggcgcaacagaccgagcatctg
tacatgaatctccgtatcgcgtcggactcgagtatcgccaagctcaagcgggtcacaaag
acgctggacttctcagggttcaataactcgaccacggtgcgtgtccgtatcaagcgtgcc
gcgtccatccgacaactgtaccgtcgtgtgtataaggagacgggtgtacccatgtcaaga
caacgactgtggaaagttatcacgcgcgagaaccgcacgacacggccggatctgccactt
ggtccggacgtctatgagtcttgtgtggactcgttaattgaggacgacgcctcacctaag
actcctgttaaaatgtatctccaaatcctggacgcgacgtctgaagctgcactttccccg
gcgtcgccgtcgtcgccatcgatccacgacgtacgagacaagaagaccaggacagcagct
atccaccggcatttcctggacgaattctcgcctccagagacgaaagacgaggccaaaccg
agtcaagaactggacgaggacgacgctgttttgcatgagtctactgacagcgtcgtagag
catgctccgccactgcaaagtcacgatattttactgattatcaagttctacgacctcaag
aagaaactcggcgaaagactggaatacgtgggcaatgtcgtggtggattcgcggttaact
ggcgcccaactggccgactatctgcatgaggcactggcgatcccctcatctagacgaatt
ctgttatttgaggaagttcagcccgtcacggtgtcgacgatttgcttggagacgccactc
gccactgctgagatccagaacggagacatcatttgcttccagtatgcagaagacgaggaa
ccggtggacgatatcgtgctcaagccggatccggaagacaatccggacgccgtggagacg
tacattggtccagacggacaggaaagacggtcgtatccggacgtccgatcctacttccgg
tacctgttagaccgcgtggaagtgacgttttatcgctatggacactcggacgaattcttc
actctccaattactactcagcaatttgtacattgaggtgatcgacgcagtggcagcgcat
ctcgatctcattggtccaaaaagactgtttgtgcgactgtaccagcactcgccactcaat
aatttgcccatgaaggcgccactgcgtcactcccgctatgctgcggatgatcaaacgaca
ctggacgatttactcactgagtatatggagcgtaccaacatcttgcactacgaactactg
gagcatccgatcacggagattgaagccaagaaggaacttctggtgcatttgagtatctac
gacgcctgctttgctacggaacaggctgcgtcgccgtctcctgttgcgccgcatcgcagt
gttgaagtgctcgtgctgcctactcacaaagtttgtgacctgctaaaacttataagaggc
ggattcggactaccgaaggacacgcctctacgtgcgtgcgaggtagtacaacatggaacg
atgatccggcgcgtgattaaggaggacgcagagctgaagcgatactggggaactggccac
ggagcggatgccaatacacccgagattttggtagaacagatccccatcgacgagttgagt
gatgaaatctctgaaactttatcgaaggacaacatgtcggatgacgagcggccgttgtgg
ttctaccgaggcgtggtgcatttcaacttccagaacaacgcgaacaagtggatccatccg
cacggcgtgccctgcatcgtgcgcttcagtgagcaagagactgtcggtgaagtcaaggag
cgcatccggcaacgaatgggcatcgcttcggatgttttcgcgcaatggaagttcgcgttg
gtgaaagatctcaaggcgtcgacgttgcaggccgtgtacgacgatatggaggcagaggcg
ttagatgcgttccccatgtcgaggctcacagagctctgtggcgcggactttgagaatcta
ggcaacttgggactggagcacgcagacccgacgccaccgccgcgtcaccacagcaacaga
aggcaggaaacagggatccacatccgccagagttga

DBGET integrated database retrieval system