KEGG   Phytophthora infestans: PITG_11486Help
Entry
PITG_11486        CDS       T01333                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PITG_11486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 205 aa AA seqDB search
MAWRCSALSNDGLVDNLARAGIVQSQSVIRAMKATDRAQYRLGYEQTISAPHMHAYALEL
ADVALHNIEYPRVLDVGAGSGYLTACLGHLVDEGGKIFGIERIPQLAQLAQQNIERADGD
LVHRRIVSVQMDGRDCFIHVGAAAVEPPQALMEQLAVGGRLVVPVGEQGASQVLMEIQRT
DKETFTRRELMGVSYVPLVRQRTEL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcgctgtagcgctctatctaacgacggactggtggacaacctagcgcgcgct
gggatcgtacagtcgcagagtgtgatccgcgcaatgaaggccacagaccgtgcacagtac
agactcggctacgaacagacaatatcagcgccacatatgcacgcgtatgccctggagttg
gcggatgtagccttgcacaacatcgaataccctcgagtcctggatgttggcgcaggatcg
ggatatctgacagcatgtctaggccacctcgtggatgaaggagggaagatctttggtatt
gaacgcatccctcaattagcgcaattggcgcaacagaatattgaacgagccgacggagac
ctggtgcaccgacgcatcgtctcggtgcagatggatggacgggactgctttattcatgtt
ggggcggctgcggttgagccaccacaagcactgatggagcagttggcggtgggagggagg
ctagtggtgcctgtgggcgaacagggggcgagtcaagtgctgatggagatccaacgcaca
gataaagaaactttcaccaggcgtgagctcatgggtgtgtcgtatgttccactagtgcga
cagcgcacggaactgtag

DBGET integrated database retrieval system