KEGG   Phytophthora infestans: PITG_12161Help
Entry
PITG_12161        CDS       T01333                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate synthetase
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
pif  Phytophthora infestans
Pathway
pif00330  Arginine and proline metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PITG_12161
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     PITG_12161
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PITG_12161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Aldedh
Motif
Other DBs
NCBI-GeneID: 9473170
NCBI-ProteinID: XP_002900781
UniProt: D0NJ70
AA seq 757 aa AA seqDB search
MRKETMTHSHTFGGYAGERPITRHDLKHATRIVVKMGTSVVSTNGEPALGRIASIVEQVC
MLKRQGKEVLLVTSGSVGIGRKRLNKQILLSASLRTHVQGNQQMLALEKKKGAMAAAGQV
GLMSLYETLFSLYDVACSQVLVTASDFKTAQNRANMRDTMLNLLELDVVPIVNENDAVSA
SPDGTVFTDNDSLAALVGGEIEADLLMLLTDVEGLYNKPPSQPGAKVISVFRPENNSFKI
GEKSSVGRGGMGAKIEAAQSAISQGVNAVVIASGFKYGVVNSIMKGSSLGTLFVANPGVE
SPDSMSAEEMANAAREGCHQLQALSSEERADILFRIADELKNNSKSILNANRKDLQAAQK
SSIDEGLIARLKLSEEKLETLADGIRSIAESEEPIGRMLKRTELASGLVLHQETASIGVL
LVIFESRPDSLPQIAALALRSGNGLLLKGGKEALHSNAVLHKIIVKAVEDATNGKVKKDV
IGLVTSREEISDLLRLDDVIDLCIPRGSGSMVSFIKKNTRIPVLGHAEGVCHMYIHSAAD
VKKAIELAIDAKTDYPAACNALETLLLDESLVSSGQDKEILVKLEEAGINLHIAPNAAKL
GVATAKSRPTDTLSTEYGSPDLTIEVVKGVGAAIAHINQYSSGHTECIVTEDAVAAEQFQ
QMIDSACVFHNASTRFADGYRFGLGAEVGISTGRIHARGPVGVEGLLTTKWKLVSESGHT
VSQFSSTKSNHPLKYTHKKLELIQKEANVARPRSSRL
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaagaaactatgacccactcgcacaccttcggcggctatgctggtgagcgcccc
atcacgcgtcacgacctcaagcacgccacgcgtattgtggtcaagatgggaaccagtgtg
gtgtccaccaacggcgagcccgcgcttggtcgcattgcctccatcgtggagcaggtatgt
atgctcaagcgccagggtaaggaggtgctactggtgaccagcggctccgtcggcatcggc
cgcaagcgcctcaacaagcagattctgctgtctgcctcgctacggacgcacgtgcagggc
aaccagcagatgctggcgctcgagaagaagaagggcgcaatggccgccgctggtcaggtt
ggtctcatgtccctctacgagactctcttctcgctgtacgacgtggcctgctcgcaggtg
ctcgtcacggcctccgacttcaagacggcccagaaccgtgccaacatgcgcgacacgatg
ctcaatctactggagctggacgtcgtccccatcgtcaacgagaacgatgctgtcagcgcc
tcgcccgacggaactgtcttcacggacaacgactcgctcgctgcattggtgggcggcgag
atcgaagccgacctcctgatgctgctcacggacgtggaaggactgtacaataagcccccc
agtcagcctggtgccaaggtcatctcggtcttccggcccgagaacaacagcttcaagatt
ggcgagaaatcgagtgtcggacgtggcggtatgggcgccaagatcgaggctgctcagtca
gcgatttcacaaggagtgaacgcggtggttattgccagtggcttcaagtacggcgtggtg
aattccatcatgaagggctcaagtcttggtacgctcttcgtcgccaaccctggtgtcgag
tctcccgactccatgtcagccgaggagatggccaacgctgctcgcgaaggttgccaccag
ctccaggctctgtcttcagaagaacgtgctgacattctgttccgtattgccgatgagctc
aagaacaacagcaagtcgattctcaacgccaaccgcaaggatcttcaggccgcacagaag
tcctctattgacgagggacttattgctcgattgaagctgtcagaagagaagctggagaca
cttgccgacggtatccgaagtatcgccgagtccgaggaaccgattggtcgtatgctgaag
cgcacggagctggcgtctggcctggtgctgcatcaggagacagcatcgattggtgtgcta
ctcgtcatcttcgagagccgtccggactcgctcccgcagatcgccgcacttgctttgcgt
agtggcaacggtctgctgctgaagggcggcaaggaggcacttcacagtaacgctgtgctg
cacaagattattgtgaaggcggtggaagacgcaacgaacggcaaggtgaagaaagacgtc
attggtctggtcacgtcacgtgaggagatttcagatctgttgcgtctggacgacgtcatc
gatctgtgcatccctcgtggctcgggctccatggtcagcttcatcaaaaagaacacgcgc
attcctgttcttggccacgctgaaggtgtgtgccacatgtacatccacagtgcggctgat
gtgaagaaggccattgagctcgcgattgacgctaagacggactacccggctgcttgcaat
gcccttgagacgctgctattggatgaatctctggtgagcagtggccaagacaaggagatc
ttagtgaagcttgaagaggcaggtattaatctgcacatcgcccccaacgctgccaagttg
ggtgtcgctacggccaagtcgcgtcctaccgacacactgtccaccgagtacggctccccg
gaccttacaatcgaggtggtgaagggcgttggcgctgccattgctcacatcaaccagtac
agcagtggccacactgagtgtatcgtgacggaggacgccgttgctgccgagcagtttcaa
cagatgattgacagcgcctgtgtgttccacaacgccagcactcgctttgctgacggttac
cgcttcggtttgggcgctgaggtcggcatcagtactggtcgcattcacgctcgtggacct
gtgggcgtcgagggtctgcttaccaccaagtggaagcttgtgtctgagagcggccacacc
gtctcgcagttctcgtcaaccaagagcaatcatccgctcaagtacacgcacaagaagctc
gagctgatccagaaggaggcaaatgttgcccgcccgaggagtagccggttgtaa

DBGET integrated database retrieval system