KEGG   Phytophthora infestans: PITG_12161Help
Entry
PITG_12161        CDS       T01333                                 

Definition
delta-1-pyrroline-5-carboxylate synthetase
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
pif  Phytophthora infestans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pif01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pif00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 757 aa AA seqDB search
MRKETMTHSHTFGGYAGERPITRHDLKHATRIVVKMGTSVVSTNGEPALGRIASIVEQVC
MLKRQGKEVLLVTSGSVGIGRKRLNKQILLSASLRTHVQGNQQMLALEKKKGAMAAAGQV
GLMSLYETLFSLYDVACSQVLVTASDFKTAQNRANMRDTMLNLLELDVVPIVNENDAVSA
SPDGTVFTDNDSLAALVGGEIEADLLMLLTDVEGLYNKPPSQPGAKVISVFRPENNSFKI
GEKSSVGRGGMGAKIEAAQSAISQGVNAVVIASGFKYGVVNSIMKGSSLGTLFVANPGVE
SPDSMSAEEMANAAREGCHQLQALSSEERADILFRIADELKNNSKSILNANRKDLQAAQK
SSIDEGLIARLKLSEEKLETLADGIRSIAESEEPIGRMLKRTELASGLVLHQETASIGVL
LVIFESRPDSLPQIAALALRSGNGLLLKGGKEALHSNAVLHKIIVKAVEDATNGKVKKDV
IGLVTSREEISDLLRLDDVIDLCIPRGSGSMVSFIKKNTRIPVLGHAEGVCHMYIHSAAD
VKKAIELAIDAKTDYPAACNALETLLLDESLVSSGQDKEILVKLEEAGINLHIAPNAAKL
GVATAKSRPTDTLSTEYGSPDLTIEVVKGVGAAIAHINQYSSGHTECIVTEDAVAAEQFQ
QMIDSACVFHNASTRFADGYRFGLGAEVGISTGRIHARGPVGVEGLLTTKWKLVSESGHT
VSQFSSTKSNHPLKYTHKKLELIQKEANVARPRSSRL
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaagaaactatgacccactcgcacaccttcggcggctatgctggtgagcgcccc
atcacgcgtcacgacctcaagcacgccacgcgtattgtggtcaagatgggaaccagtgtg
gtgtccaccaacggcgagcccgcgcttggtcgcattgcctccatcgtggagcaggtatgt
atgctcaagcgccagggtaaggaggtgctactggtgaccagcggctccgtcggcatcggc
cgcaagcgcctcaacaagcagattctgctgtctgcctcgctacggacgcacgtgcagggc
aaccagcagatgctggcgctcgagaagaagaagggcgcaatggccgccgctggtcaggtt
ggtctcatgtccctctacgagactctcttctcgctgtacgacgtggcctgctcgcaggtg
ctcgtcacggcctccgacttcaagacggcccagaaccgtgccaacatgcgcgacacgatg
ctcaatctactggagctggacgtcgtccccatcgtcaacgagaacgatgctgtcagcgcc
tcgcccgacggaactgtcttcacggacaacgactcgctcgctgcattggtgggcggcgag
atcgaagccgacctcctgatgctgctcacggacgtggaaggactgtacaataagcccccc
agtcagcctggtgccaaggtcatctcggtcttccggcccgagaacaacagcttcaagatt
ggcgagaaatcgagtgtcggacgtggcggtatgggcgccaagatcgaggctgctcagtca
gcgatttcacaaggagtgaacgcggtggttattgccagtggcttcaagtacggcgtggtg
aattccatcatgaagggctcaagtcttggtacgctcttcgtcgccaaccctggtgtcgag
tctcccgactccatgtcagccgaggagatggccaacgctgctcgcgaaggttgccaccag
ctccaggctctgtcttcagaagaacgtgctgacattctgttccgtattgccgatgagctc
aagaacaacagcaagtcgattctcaacgccaaccgcaaggatcttcaggccgcacagaag
tcctctattgacgagggacttattgctcgattgaagctgtcagaagagaagctggagaca
cttgccgacggtatccgaagtatcgccgagtccgaggaaccgattggtcgtatgctgaag
cgcacggagctggcgtctggcctggtgctgcatcaggagacagcatcgattggtgtgcta
ctcgtcatcttcgagagccgtccggactcgctcccgcagatcgccgcacttgctttgcgt
agtggcaacggtctgctgctgaagggcggcaaggaggcacttcacagtaacgctgtgctg
cacaagattattgtgaaggcggtggaagacgcaacgaacggcaaggtgaagaaagacgtc
attggtctggtcacgtcacgtgaggagatttcagatctgttgcgtctggacgacgtcatc
gatctgtgcatccctcgtggctcgggctccatggtcagcttcatcaaaaagaacacgcgc
attcctgttcttggccacgctgaaggtgtgtgccacatgtacatccacagtgcggctgat
gtgaagaaggccattgagctcgcgattgacgctaagacggactacccggctgcttgcaat
gcccttgagacgctgctattggatgaatctctggtgagcagtggccaagacaaggagatc
ttagtgaagcttgaagaggcaggtattaatctgcacatcgcccccaacgctgccaagttg
ggtgtcgctacggccaagtcgcgtcctaccgacacactgtccaccgagtacggctccccg
gaccttacaatcgaggtggtgaagggcgttggcgctgccattgctcacatcaaccagtac
agcagtggccacactgagtgtatcgtgacggaggacgccgttgctgccgagcagtttcaa
cagatgattgacagcgcctgtgtgttccacaacgccagcactcgctttgctgacggttac
cgcttcggtttgggcgctgaggtcggcatcagtactggtcgcattcacgctcgtggacct
gtgggcgtcgagggtctgcttaccaccaagtggaagcttgtgtctgagagcggccacacc
gtctcgcagttctcgtcaaccaagagcaatcatccgctcaagtacacgcacaagaagctc
gagctgatccagaaggaggcaaatgttgcccgcccgaggagtagccggttgtaa

DBGET integrated database retrieval system