KEGG   Phytophthora infestans: PITG_12226Help
Entry
PITG_12226        CDS       T01333                                 

Definition
Phosphatidylinositol kinase (PIK-L2)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pif  Phytophthora infestans
Brite
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   PITG_12226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2659 aa AA seqDB search
MAESFTRFLPGLRSSNSSVRHRAAQSLRLYIESESRDLSHGLYMKWVTDISARLMLLCNS
NENADRMGGIAAMDELVELFIAERNDQTIIEFAHSLTKVFEKIPSADPPMLRVAAKALGH
IVSTGGTSLIEFVEDYHVKPALEWLKNETFHVRRHAAVMILKELSINAPSTSFRYMDKYF
DFIWSAFWDSKLVVRVSASESLQSCFMLIQQRESNRKTSWYNRALDEAEGAFKRNSSDAT
HGALLILNELLRNTGDFMHSHYGRACRLVFSHQDHKSATVRSAVISLFPRLAKFNTSVFV
EKCYRPCMNHLLEVLFSATTTTRPDALLSIGKLSLAIGPLLARDEQALMAIMNGIKGGLQ
VRKKDFDTHREALACLRMLADTVGPALIRVDLESMVGPLFQNDLDSPLVETLTTIVKKIP
PMKPIIQQKLFERLSSILRSSHNNATGSASTPTSRRLKTTSISVTGGMLSNLFLSATGAK
TNGTSENGAPSAEVSSAIAMQALALETLANFDFQGNRLIPIMSFVHETVVKFLDHEVATI
RKSAALTCCKLLLPQGEDRGGNTAMTSEDFARPVTSVLERLLTVGIADNEASIRLRVLAS
LDSRFDPLLALNDNLRCLFIALNDEVFSIRQTAMSTLGRLTHHNPSTVLPSLRQTLVQLL
AELEFSGDSRGKEEGALLVGCLLRSASQLAQPYVLPILRVLMKNLREDSERRSHSRSTVS
VSKAILATLGDLAEVGAQELTPYLGQLLPDVIDEMRDSSNPQILQVAIKTLGQLVSSTGY
VVLPYHEYPELLDLLCQALQKSGDAFESLRIEAGRTLGVLGALDPYNLRLFHLQKQGKLT
DAKKKEFRSTAFAVDAGGVFSLMAIAANPSQTFSTNGFGSGPNATNGALIGIRIGNGIGG
PGVLDGSSEEDAQQLGESLLLTPARKVEKSDKKTSGKLTNIILEVPPDDLLPSMIPDSSQ
YFPTVATNALIRILLEPRNSVHYQGTFMAIMYICKSQRKRMGQHLDKIIPAFLYALEKVN
RSLRKFLFEQLCDLVQIVEEQIQPHLDHVALLSIVNSYWDEHLEEVLNLVKKLANSLGEK
FRVYLPDLIPQMLRVIRTERDNPARPRTLLVLKTSVSLGRLLDGYLHLIIPALVALIQSD
ADINARKQGLGSLGSLVKKLNVSVYASKIIHMLARVISSQPEMVYLAMDCLCCMVYTMGD
DYAIFVPVISQVLGRHTSRSNDIFDRYDLLVSKILKYQPLPVASWATDPLKARVDTSNDH
KDSSLAGQDETKSLPCDQKNLVKAWEASQRSTKEDWNEWILAFSVELLRESPSPVLRACK
ELASVYQPLARELFNASFVSVWPHLSSATQDNLIRSLESAFQSPHLPSEILQTLLNLAEF
MEHDDQPLPIDIRLLGSLADKCHSFAKALHYKELEFNTNPSTDGIQALISINSKLNQPEA
ARGILKYALEKLPGIEVKASWHEKLLRWDDALVTHDRVLLDNPNNVEAIFGKMRCLWAIG
EWRKLNDHVQETWSKIYGEGQDLNGEQEDGEKLLDVPPALKRELCSSGARVAFSLQNWDS
IPKYINSDMDATESHLFKAVVSIRRMELDEAMNSIGDCRKEMDPTLRSLVSESYARAYLP
AVVNLQMLTELEEIVSYLKTFAYKNNGELTLLSTPASSTSMSTTASRRKQSISSLNFVSS
SSSTSYGHEKQVALKKLQTIWTRRMLGVERNIQVWQSLMLVRSLVFDPREDVDIWLKYAR
LCLKSGHINLAASALWRVGAQPFIRSVERDPYAPIPINLGGNAGASQGFANGLLSLADSA
AQDPRVAFSYLRHLWAENREDVALKQMDYFIEALEQHGDPTNEDLRKLRVQVYIQLGEWQ
MSLTEPHKQSYDHVLECLETATKLDPTNDRAWHEWALMNFRALEATVKESGQGDPKRYAV
RAIQGFFRSISFGHTSYDVTKDVLRLLTLWFTQGNRSDVHMAMVEGFQEASVDTWLDVIP
QLIARIDTPNPKTSELLHDLLSRIGQAHPQALIYPITVASKALNPTRKHAAEGILAAVRR
HSSQLVYEADMVSRELIRVAILWNELWHGALEEASKHFFNNRDVTAMIAELAPLHEQMDK
IGTEESPTLREVAFYQAFARDLAYAKEWTNVYERTKSLDDLNQAWDIYYSVFSKIRKQLA
NLSTLELGNVGPKLLSVYNLTLAVPGTYKAGAPIVRIHSFDTKVTVLTSKQRPRKVTING
SDGKAYPFLLKGHEDLRQDERVMQLFGVINTLLANDSDTSKRNLAIQRYSVLPLSHTSGL
IGWVPNCDTLHQLIRDYREARKIQLNVEHRLMVQMAPDYDKLPLMQKVEAFKYALGETTG
QDLYRVLWLKSQDSEVWLDRRRNFTRSLAVMSMAGYILGLGDRHPSNLMLDRVSGKLVHI
DFGDCFEVAMERDKYPEKIPFRLTRMLTQAMEVSGIEGNFRYTCEASMRVLRDNRDSLMA
VLEAFVYDPLINWRLLKKDAVPSHAQPEEDDGAGAGRGDVTDASVDRSSERVGNEDEADA
DGEGDVANGGHVDEDKLAEGSMKSSTSSAPVTPRRRRHSSSEAAMLGYNMDLLDPAIARN
SMSETQRDNFGTSLVAAEHPQLNEKALSVIDRVKKKLAGRDFDDGSRVLTVDAQVDRLIH
QATSHENLCQLYYGWCPFW
NT seq 7980 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagcttcacgcggttcctgccggggctgcgcagcagcaatagcagcgtgcgg
caccgtgcggcgcagagcttgcggctgtacatcgagtccgagtcgcgcgatctgtcccat
ggactttatatgaaatgggttaccgacatcagcgcacgcctcatgctgctgtgcaactcg
aacgagaacgcagatcgtatgggcggtattgcagccatggacgagcttgtagagctcttt
atcgctgagcgcaacgaccagactatcatcgagttcgcccattcgcttactaaagtcttt
gagaagatcccaagcgcagacccgcccatgctacgtgtagctgccaaggcgcttggtcac
attgtgtctactggcggtaccagtctcattgaatttgtggaggactatcacgttaagccc
gcgctcgagtggctgaagaacgagacatttcatgtacgtcgccacgccgccgtcatgatc
ctcaaggaactatctatcaacgcgccgtccacgtccttcagatacatggacaagtacttt
gacttcatctggagtgcgttctgggactcgaaactcgtagtaagagtgagtgccagtgag
tcgctccagtcctgttttatgctgatccaacagcgcgaatccaatcgtaaaacgtcgtgg
tataaccgcgcactggacgaagccgagggtgcctttaagcgtaacagctcagacgctaca
cacggagcgctgttgattctgaatgagctactgcgcaatacaggagactttatgcactca
cactacggccgtgcttgtcgtctggtcttcagccaccaggatcacaaaagcgctactgtt
cgctctgctgtaatcagtctgttccctcgtttggccaagtttaacacgtcagtgttcgtg
gagaaatgctatcgtccctgtatgaatcatttgctcgaggttctcttctcagctacgacg
acaacacgtccggacgcgctgctttctattggaaaactctcgttggctattggaccgcta
ctagcgagggatgaacaggctttgatggcgattatgaatggaattaagggcggattacag
gtgcgtaagaaggacttcgatacacatcgagaggcactcgcgtgtctacggatgctggcg
gacacggtgggtcctgcactcatcagagtcgacttggagtctatggtggggccgctgttc
cagaacgacttggactcgccactcgtggagactctgacgactatcgtcaagaagatccca
ccgatgaagcctattatccaacagaaattgttcgaacgactaagttcgatcttgcgctcc
agtcacaacaatgctacgggatcggcgtcgactcctaccagtaggagacttaaaacaacg
tccatttcagtgacgggaggcatgctatcgaatctgtttctgtccgctacgggggcaaag
actaatggaacgtccgagaatggtgctccgtcagctgaggtgtcgtcggctattgcgatg
caggcgctggcattggagacgctggcgaacttcgacttccagggcaaccgactcatccca
atcatgtcttttgttcacgaaacggtggtgaaatttcttgatcatgaggttgcgactatc
cgcaagagtgctgccctcacgtgctgtaagctgctactgccgcaaggtgaagatcgtggt
ggcaacacggcgatgacttcggaagactttgcgcgtcctgtcacgtcggttctggaacgt
ttgttaactgtgggtatcgccgataatgaagcgagtattcgactgcgtgttctcgcgtcg
ctggactcccgattcgacccgctgctagcactgaacgataacttgcggtgcctatttatt
gcgttgaacgatgaggttttcagtattcggcagacggccatgagcacgctaggacgactt
acacaccacaatccttctacagtgctgccgtcgcttcgacaaacattggtgcagctgtta
gcggagttggagtttagtggagactcacgtggcaaggaggaaggcgcgcttttggttggt
tgtttgctgcgttctgcttcacaactggcccagccgtacgttctccctattcttcgcgtg
ctaatgaagaatctgcgtgaagactcagagcgtcgtagtcatagtcgaagcactgtcagc
gtgagcaaagccatcttggcaacattgggtgacttggcggaagttggagctcaagagctg
acgccgtatctcggtcagctgctgccggatgtaatcgacgagatgcgagactctagcaac
ccgcagattctacaagttgctatcaaaacgctgggtcagctcgtgtcgtcaactggttat
gtggttctgccatatcacgagtatccagagctattggacctgctgtgtcaagccctacag
aagtctggtgacgcattcgagtctttacgtattgaagcaggacgtacgcttggtgtcttg
ggtgcgttggatccgtacaatctccgcctgttccatttgcaaaagcaaggcaaactcact
gatgctaagaagaaggagttccgttccactgcgtttgcagttgatgctggcggcgtgttt
agtctaatggccattgcagcgaacccttcgcaaacgttttcgactaatggatttggctct
ggtccaaacgcgacaaatggagctcttattggtattcgaattggcaatggaattggcgga
cctggagtgcttgatggcagcagtgaggaagacgctcagcaacttggagaatcgctgttg
ctcacaccggcgcggaaggtggaaaaaagtgacaagaagactagtggaaagctgactaat
atcatcctggaggtcccgcctgacgacttgctgccgtcaatgatccctgactcctcccag
tattttcctacagtcgcgactaatgcgttgatcagaatattgctggagccgcgtaactca
gtacactaccagggtacgttcatggccatcatgtacatctgcaagagccagcggaaacgt
atggggcagcatttggacaagatcatcccagcgtttctatacgcactggagaaggtgaac
cgctctctacgcaagttcttgttcgagcagctttgcgacctggtgcagattgtcgaggag
cagattcagccacacttagaccacgtggcgttgctttctatcgtgaacagttattgggac
gaacatttggaagaagttctcaacttggtcaagaaactagcgaattcgcttggtgagaag
ttccgtgtctacttaccggatctgattcctcagatgctgcgtgtgattcgtacagaacgt
gacaatccagctcgacctcggacgcttttggtgctaaaaacttcagtatcgctcggacgt
ttgttggatggctatcttcacttgattatcccagctctcgtggcactgatccagagtgat
gcagatataaatgcaaggaaacagggactgggctcactgggttcgctggtcaagaagctt
aacgtgagtgtgtatgcttcgaagatcatccacatgttggcacgtgtgatctcgtcgcaa
ccggagatggtgtatctggcaatggattgcttgtgctgcatggtgtacaccatgggtgac
gactacgcgatcttcgtaccagttatcagtcaggttctgggccgtcacacgtcacgttcc
aacgatattttcgatcgctatgaccttctagtgtcgaaaattctgaagtaccaaccgctt
cctgtagcttcgtgggcaactgatccactcaaagcgcgcgtggacacctcaaatgaccac
aaggactcaagcttagctgggcaagatgaaacgaagagtctaccgtgcgatcaaaagaac
ttggtgaaggcgtgggaagcatctcagcgatcgacaaaagaggattggaacgagtggatt
ctcgccttctcggttgaattactgcgagaatctccgtcccctgttctccgtgcttgcaag
gagctggcttcggtgtatcagcctctggctcgagagctatttaacgcttcattcgtcagc
gtgtggcctcatctttcgtctgcgacgcaagataacttgatcaggtctttggagtccgcc
ttccagtcgccacatttgccatcggagattcttcagacgctactcaaccttgcagagttc
atggagcacgacgatcaacccctaccgattgatattcgattgctcggatctttagcggac
aagtgccattcgttcgcgaaggctcttcactacaaagagctcgagttcaacacgaaccca
agcactgatgggatccaagcgcttatcagcattaactcgaagctgaatcagcctgaggct
gcacgtggtatcctgaaatacgctttggaaaagctgccaggcattgaagtgaaggcttcg
tggcacgaaaagctcctgagatgggatgacgcgttagtgacacacgatcgtgtcttacta
gacaacccgaacaatgttgaagccatcttcggcaagatgcgttgtctgtgggccattggc
gagtggcgcaaattgaacgatcacgtgcaggagacttggtctaagatctatggagaagga
caggacctgaacggtgaacaggaagatggtgagaagctgctagatgtccctcctgctttg
aagagagagctgtgcagtagtggcgcacgagtagctttctcgctgcagaattgggactct
attccgaagtacatcaactcagatatggacgctacggagtcgcatttgttcaaggcggtt
gtgtcgatccgacgaatggaactggacgaggctatgaactccatcggcgactgtcgaaag
gagatggacccaactctacgttcccttgtgagtgagagttatgctcgggcatatcttccg
gcggttgtaaacctgcagatgctgacggaactggaggagatcgtctcgtatctgaagact
tttgcgtacaagaacaacggggagctgacgcttctgtcaactccagcttcgtccacttcg
atgtctacaactgcgtcacgtcgcaagcagagtatcagcagtctcaactttgtgtcgtct
tcgtcgtccacttcgtatggacacgagaagcaagtagcgctgaagaaattgcagacgatc
tggacgagacgtatgctcggagtggagcgcaacatccaagtgtggcagagtctcatgttg
gtgcggtcacttgtgtttgatcccagagaagacgtcgatatctggctcaagtacgcgcgc
ttgtgtctgaaatcgggacatattaaccttgcagccagcgcactctggcgtgtcggagca
cagccgttcatccgcagtgttgaacgagacccgtatgcgccgattccgatcaatctcggt
ggtaacgctggagctagtcaaggtttcgcaaatggcttgttgagtctagcggacagtgca
gcgcaagacccgcgggtggccttcagctacctgcggcacttgtgggcagagaaccgcgaa
gatgtggctttgaagcaaatggattacttcatcgaagccttggaacaacatggggatcca
acgaacgaggatttacggaagctgcgagtacaagtgtatattcaactgggtgagtggcaa
atgtcccttactgaaccacacaagcaatcgtacgaccatgtcctcgagtgtcttgagaca
gcaacaaagctggatccaacgaacgatcgcgcgtggcatgagtgggcgcttatgaacttt
cgagcgcttgaggccactgtgaaggaatctggccaaggagatccgaaacgttatgctgtt
cgcgccatccagggtttcttccgatcgatctcattcggccatacaagctacgatgtgacc
aaggatgttctgcggctgttgacgctttggttcacgcaaggaaatcgtagcgatgtgcac
atggctatggtcgagggtttccaggaggcgtcagttgacacgtggctggatgtgatcccg
cagcttattgcgcgtatcgatacgccgaacccgaagaccagcgaactgctgcatgaccta
ctctctcgaattggacaagcccatcctcaggctttgatttatcccattacggtggcgtcc
aaggcgctgaacccgacgcggaagcacgcggcagaaggaatccttgctgctgtacgtcga
catagctcccagctcgtgtacgaagctgacatggtgtcgcgtgagctcattcgcgtggct
attctgtggaacgaactgtggcatggcgctctcgaggaagcgtcgaagcatttcttcaac
aatcgtgatgtgactgctatgattgctgagctggctccgcttcacgagcagatggataag
atcggcacagaggagtcgcctacgcttcgtgaggtggcattctatcaagcattcgctcgg
gatctggcgtacgcgaaggaatggacgaatgtatacgaacgcacgaagagtctggacgat
ctgaaccaagcatgggacatctattacagtgtgttctcgaagatccgtaagcaattggca
aacctgtcaacgctggagcttggaaacgtcggtccgaagttactatccgtgtacaacttg
acccttgcggtgccaggaacatacaaggctggcgctcctattgtccgtatccattctttc
gacacgaaggtgactgtgttgacatcgaagcagcgacccaggaaggtgacgatcaatgga
agtgacggtaaggcctacccgtttctactcaagggccatgaagatttgcgtcaggacgag
cgtgtgatgcagctttttggtgtgatcaacacgctgctggccaacgacagtgacaccagc
aagcgtaacttggctatccagcgttattcggtgctgccgctgtcgcacacgagtggtctt
atcggctgggtgcccaactgtgacaccttacatcagcttatccgtgattaccgtgaggcg
cgtaagatccagctgaacgtggaacaccgcctgatggtgcagatggctccagactacgac
aagttaccgctcatgcaaaaggttgaagctttcaaatatgcactgggcgagacgacaggc
caggatctgtaccgagtcttgtggctgaagagtcaagactcggaggtttggctcgaccgt
cgacggaacttcacgcggtcgctcgccgtcatgtcaatggctggatacattctcggtctt
ggtgatcgtcacccgagtaacctcatgctggaccgtgtgtctggtaaactcgtgcacatt
gactttggcgactgctttgaagtagcaatggagcgcgacaagtacccggagaagatcccg
ttccgactcacacgtatgcttacacaggcaatggaggtcagtggtattgaaggcaacttt
cgctacacctgtgaagcttcgatgcgtgtgcttcgtgataaccgcgactcgctgatggcg
gtgcttgaggcgttcgtgtacgatccgctcattaactggcgtctacttaagaaggatgcg
gtgccgtctcatgctcaacctgaggaagacgacggcgctggtgcgggacgtggcgatgtc
acagatgccagcgttgacaggagttctgagcgtgttggcaacgaagacgaggccgatgca
gacggcgaaggtgacgtcgcgaatggaggtcacgtcgatgaagacaagctggcggaaggt
agcatgaagagctcgacgtcgtcggctcccgtgacgcctcgaaggcgacgacactcttcg
tctgaagcagcgatgctgggctacaacatggacctgttggacccagcgattgcacgcaac
tccatgtcggagacacagcgcgacaacttcggcacttcgctcgtcgctgcagaacaccct
cagcttaacgagaaggcgttaagtgtcattgatcgtgttaagaagaaactggccggtcga
gactttgatgacggtagcagagtgcttactgtggacgctcaagtggatcgactgatccat
caagccacgtcgcacgagaatctgtgtcagctctactacggttggtgtccattctggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system