KEGG   Phytophthora infestans: PITG_12228Help
Entry
PITG_12228        CDS       T01333                                 

Definition
NADH-cytochrome b5 reductase, putative
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pif  Phytophthora infestans
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PITG_12228
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PITG_12228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 299 aa AA seqDB search
MWSTMIMRFPTQAKSVSRSALVAAGMAAFAAFSSVSSTRCEEEKSKVALSPKEFRSFTVR
KVETVNYNTKRVTFALPTPEHEMGLTTPSCLMARAKVDGKTVVRPYTPVNVNDEKGFLEL
VVKGYPQGKLSKHIVQLKEGDSLDMKGPFPKFNYYPNRYKSIGMIAGGSGITPMLQLIKA
ICRNPEDRTEITLLYCSVSEEDIILREEVEAMMYLYPQISVIHVLSNPSAEWKGLTGFVS
KEMIEKYMPEPSDDNLVCVCGPPPMMYHVSGDKAKDRSQGELQGLLKDMNYTSTQVFKF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcgacgatgatcatgcggttccctacgcaggccaagtccgtgtcgcgcagcgcg
cttgtggcggcaggtatggctgcgttcgctgccttctccagtgtttcctctactcgctgc
gaagaggagaagtccaaggtggcgttgagccccaaggagttccgttctttcactgtgcgt
aaagttgagaccgtgaactacaacacgaagcgcgtgacgttcgctcttcccacacccgag
cacgagatgggtctcacgacgcctagttgccttatggctcgtgccaaggtagacggcaag
acagtggtgcgcccctacacgcctgtcaacgtgaacgacgagaagggtttcttggagctc
gtagtcaagggttacccacagggaaagctcagcaagcacatcgtgcagctcaaagaagga
gactctcttgacatgaaaggtccctttcccaagttcaattactaccccaacaggtacaag
agcatcggcatgatcgctggcggctccggtatcacccccatgctgcagctcatcaaggcc
atttgccgcaacccggaggaccgcaccgagatcacgctgctgtactgcagtgtctcggaa
gaagatatcatcctgcgtgaagaagtggaggccatgatgtacctgtacccgcagatctcc
gtgatccacgtgctcagcaacccgtccgccgagtggaagggtcttacaggcttcgtgtcc
aaggagatgatcgaaaagtacatgccggagccgtcagacgacaacctcgtgtgtgtgtgc
ggtcctccgccaatgatgtaccacgtctcgggtgacaaggcgaaggacaggtctcagggc
gaactgcaaggtctgctgaaagacatgaactacacctccactcaagtgttcaagttttaa

DBGET integrated database retrieval system