KEGG   Phytophthora infestans: PITG_12682Help
Entry
PITG_12682        CDS       T01333                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pif  Phytophthora infestans
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PITG_12682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 112 aa AA seqDB search
MVNVAGGKGDAAKGAKIFKTKCAQCHTTNAGGAHKQGPNLAGMINRQSGQAENYSYSAAN
KNSGVVWTDETLFEYLLAPKKYIKGTKMVFAGLKKPQERRDLIAYLMEATNE
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggttaacgttgccggcggaaagggagacgctgctaagggcgccaagatcttcaagacc
aagtgcgctcagtgccacaccactaacgctggtggcgctcacaagcagggccccaacctt
gctggtatgatcaaccgccagtccggccaggctgagaactactcgtactcggctgccaac
aagaactcgggtgtcgtttggactgacgagaccctgttcgagtacctccttgctcccaag
aagtacatcaagggtaccaagatggtgttcgccggcctgaagaagccgcaggagcgtcgc
gacctgatcgcttacctgatggaggctaccaacgagtaa

DBGET integrated database retrieval system