KEGG   Phytophthora infestans: PITG_12764Help
Entry
PITG_12764        CDS       T01333                                 

Definition
ubiquitin-specific protease, putative
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PITG_12764
Peptidases [BR:pif01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PITG_12764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 739 aa AA seqDB search
MLAMAPRAAELTPASSRLPSPAPPSFKHAKVPTNSAKTSLNETANPVSSNGLLPFKAQCK
SAVVLVNERRIDFVRAKNVRVIGRLDGNSSETKPKKKETKEITSNDSVERVLAWKHSKKI
GPGFANLGNTCYLNSVLQCLTYTPCFAQFLLDKEVFASFNSGALPSTGNKFNKKFGKNGF
SGNSGNAGGNGFCSVRAMSRLLQSVHGNNAVRVLQPKELVMNVRHISKSFRIGRQEDSHE
FFRLLLDSMQRSCLRKAHIKSESHSAASTTFVYRMFGGKLKNHLKCAKCGFVSERFDDFL
DLSLEISNGVHSVKGALRHFTAIEKLDERNAWKCSSCGKPSRAEKGLSIAECPNVLMIQL
KRFDLMFGKIKRHIEFPRSLDIASGMSKNCEDRRRGRTKYELHAVLVHAGFSTDCGHYYA
FVKGSSGQWYEMNDDSVRWVSLDTVLQQKAYMLFYSRVLPPSERPKSKAKEEEEVKAKAK
EVVKAASQEEIPEKTAASKTVLAKTKELDMNGFLASLKTAVATDDKPMAVTPAHHQTVVT
FKVKSKPSNDTPVVARPRIKRSLTPTFGGRVGRIHRFGSASWKSCPRLVMTQSVREFPEE
STVASKTVATVAKTSGMTKVPFDPRQLKNVGVRNAALFGREVDKWTGETDVESSETTSSD
VAVDSALAAKHDRVLNALKQEEWKQRNAGRQDYWDETLDIGKVKKVKKRKEFVANEGRKN
AFQTALMRKKKDAKRQRTA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgctggccatggcaccacgcgccgcggagctgacgcctgcgtcgtcccgactcccatcg
cccgcgcctccgtcctttaagcacgcaaaggtgccgaccaatagtgcgaaaactagcctg
aacgaaaccgccaaccctgtgtcaagcaacgggttgctccctttcaaggcgcaatgcaaa
tcggctgttgtcttggtaaacgagcgccgcattgacttcgtgcgtgccaagaacgtgcgt
gtaattggtcggttggacggcaactccagtgaaactaagcccaagaagaaggagacaaaa
gaaatcactagcaacgactcggtggagcgcgtactcgcatggaaacactcgaagaagatc
ggcccgggtttcgccaacttgggcaacacgtgctacctcaactcggtgttgcagtgcctg
acctacactccgtgtttcgcgcaattcctgctggacaaagaggtttttgcttcctttaac
agcggcgcgttgccatcaactggcaacaagttcaacaaaaaattcggcaaaaatgggttc
agtggcaacagtggaaatgcaggtggcaacggcttttgtagtgtgcgcgccatgtccaga
ctgttgcagtcagtgcacggcaacaacgccgtgcgggtgttgcaacccaaggaactggtg
atgaacgtgcgccacatttccaaaagcttccgcatcgggcggcaggaagattcccacgag
tttttcaggctgctgctggactccatgcagcggtcgtgtctacgcaaggcgcacatcaag
agcgaaagccactcggcggcgtccacgacgtttgtgtaccgcatgtttggcggcaagttg
aaaaatcacctcaaatgtgccaagtgcggattcgtttccgaacgattcgacgattttctg
gatttatcactggaaatttcgaatggcgtccacagcgtcaaaggtgcgttgcgccacttc
accgccattgagaaactggacgaacgcaacgcgtggaaatgctccagttgcggcaaaccc
agtcgcgccgagaaggggctttccatcgccgagtgccccaatgtgctcatgattcaactc
aagcgctttgacctcatgtttggcaaaattaaacgccacatcgagttccctcgctcactg
gacatagcctcgggaatgagcaaaaactgcgaggatcgtcgtcgtggccgtactaagtac
gaattgcatgctgtgctggttcatgccggtttctcgacggactgtggccactactatgcc
ttcgttaagggctcatcaggtcaatggtacgaaatgaacgacgactctgtgcgatgggtg
agtctcgacacggtgttgcaacagaaagcctatatgctattctattcgagggtgttgcct
ccttcagaacgcccgaaatccaaggcgaaggaggaggaagaggtgaaagctaaagccaaa
gaggtggtaaaggcagctagtcaggaggaaatacccgaaaagacggctgcgtccaagacg
gtacttgccaaaaccaaggaactggacatgaacgggttccttgccagtctgaagacagca
gtggcaactgatgacaaacctatggctgtgactcccgcccatcaccagacagtggtgact
ttcaaggtcaaatcaaaaccgtcgaacgacacgccagtcgttgcacgaccccgaataaag
cgctccttaacacctactttcggtggtcgtgtaggtcgaatccatagatttggatcggcc
tcatggaaatcgtgtccccgtcttgtgatgacgcaatcggttagggaattcccagaggaa
tccactgtggcgtcaaaaactgttgccactgttgcaaaaacgtcaggaatgaccaaagtg
ccgtttgacccgcggcaactaaagaacgtgggcgtacgcaacgccgcgttgtttggccgt
gaagtggataaatggactggcgagaccgacgtcgagtcctctgagaccacgagcagcgac
gtggcagtcgacagtgcgctggctgccaagcacgaccgtgtgctcaacgctctgaagcaa
gaggagtggaaacagcgtaacgctggccgtcaagactattgggatgaaactctcgacatc
ggcaaggtcaagaaggtgaaaaagcgcaaggagtttgttgccaacgaaggccggaagaac
gctttccagacagctctgatgcgcaagaaaaaagacgctaagcgacagcgcacggcctag

DBGET integrated database retrieval system