KEGG   Phytophthora infestans: PITG_13128Help
Entry
PITG_13128        CDS       T01333                                 

Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
pif  Phytophthora infestans
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    PITG_13128
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     PITG_13128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 435 aa AA seqDB search
MWSNKHGESQGLFPGRKTLGPLLLMTATPVAATLITHVFVTHGGSLSSFLASGKSLAEIW
PTPWDPTAWKLIGSFMATQLVLMRVVPGRPSYGPVTPGGNVPEYKANGFQCFVLSLALFL
SGAFVFDLYPGGIVYDYMPEIISALNVFSFIFCLFLYVKGAFLWQSSSDCGTSGNPIFDF
YWGTELYPRVLGWDVKLFTNCRCGLMFWAVGVLSYACKQRELYGYLSDSMAVSVALQLVY
VAKFFWWEAGYMCSIDIMHDRAGYYLCWGCLVWVPSVYTSPAMYLVQNPINLGTPLALAI
FVTGVLMVGINYDADRQRQSFRAASGKTNVWGRPAEFIVARYETEQGEKKKSLLLASGWW
GLSRHFHYVPEVLAAVCWTIPALASSPAPYFYSIFLAILLTDRAYRDDARCAHKYRQDWK
KYCERVPSLILPNIL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtggtccaacaaacacggcgagtcgcagggtctgttccctggtcgcaagacactcggc
ccgctgctcctcatgacggccacacccgtggccgccacgctcatcacgcacgtgtttgtg
actcacggcggctcactcagctccttcctcgcgtcgggcaagtcgctggccgagatctgg
ccgacaccctgggacccgacggcctggaaactcatcggtagcttcatggccacgcagctt
gtgctaatgcgcgtagtgccgggccgaccgtcgtacggacctgtgactccaggcggtaat
gtacccgagtacaaggccaacggcttccagtgctttgtactgagtctggccttattccta
tcgggtgcattcgtctttgacctgtacccaggaggaatcgtgtacgactatatgccggag
attatctcggcgctcaacgtcttcagcttcatcttttgtctcttcctgtacgtcaaagga
gccttcctgtggcagtcctcaagtgactgcgggacgtcgggcaaccccatcttcgacttc
tattggggcacggagctgtacccgcgtgtactgggctgggacgtcaagctcttcacgaac
tgtcgctgcggcctcatgttctgggccgtgggcgtgctctcctatgcgtgcaaacaacga
gagctgtacggatacctaagtgactccatggccgtgagtgttgcgttacagctcgtgtac
gtggccaagttcttctggtgggaggccggctacatgtgcagcatcgacatcatgcacgac
cgcgcgggctactatctttgctggggttgtctagtatgggtgccgtcggtctacacctca
ccggccatgtacctcgtacagaaccccatcaacttggggacaccgttggctctagccatc
ttcgtcacgggcgttctcatggttgggatcaactacgacgccgaccgccagcgtcagagc
ttccgtgcggcaagtggcaagacgaacgtatggggacgcccggccgagtttattgtggcc
cggtacgagactgaacaaggtgagaagaagaagagtctgctgctcgcatctggctggtgg
ggactgtcgcgccacttccactacgtacccgaagtgttggccgccgtctgctggacgatc
ccagcgcttgcttcaagtccggctccgtacttctactcgatcttcctcgccatcttgctc
acggatcgagcttaccgtgatgacgcccgttgcgcgcacaaatatcgccaggactggaag
aaatactgcgagcgtgtgccctcactcatcctgccaaatatcctgtag

DBGET integrated database retrieval system