KEGG   Phytophthora infestans: PITG_13139Help
Entry
PITG_13139        CDS       T01333                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pif  Phytophthora infestans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PITG_13139
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PITG_13139
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PITG_13139
Enzymes [BR:pif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PITG_13139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 497 aa AA seqDB search
MVHYRSTRGGVRGLSFEQAVLTGLASDRGLLIPEADEFPTLPADALEKWASLSYQELAVE
VMRLFIDESEISRDQLRELVTKSYNATTFRSDEVAPVVKVTDQMLVLELFHGPTFAFKDI
ALQFLGNLFEFFLKRKNEALPSDAPKHQITVVGATSGDTGSSAIYGLRGKENVEVFILFP
EGRVSAIQQRQMTTVLDQNIHNVAVKGTFDDCQAIVKDLFANADFKAKYNLGAVNSINFA
RILAQIVYYVWAYFRAHDEGVSGEVAFSVPTGNFGDILAGFYAKKLGVPIGKLIVATNEN
DILHRFFSTGKYHRRDIEHTISPSMDICVSSNFERYLFALSGENHDILRGWMQAFEQTNE
LTISGELLSKAQDEMASYAVLQEQVRSTIAEYKTMHQYLFDPHSAIGAAAAMHFVQDNLA
DKPNSAVVVVGTAHYGKFLPVVSKALGVAESEIEQHPILKALESLPTRLSVASNSSETVA
EHIRKIIAEKNDEACSD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtgcactatcgtagtactcgcggcggcgtccgcggccttagctttgagcaggcggtg
ctgacgggcttggcttccgaccgtggcctgctgatacccgaagctgacgagttccctacg
cttccagctgatgcgctggagaagtgggcgtctctttcgtaccaggaattggccgtggag
gtcatgcgccttttcattgacgaaagcgagatctcgcgtgaccagctgcgtgagcttgtg
accaagagttacaacgcgaccacgttccgctccgatgaggtggcgccggtggtcaaggtg
acggatcaaatgctggtgcttgagctcttccatggccccacgtttgcctttaaggatatc
gctctccagtttctaggcaaccttttcgagtttttcttaaagcgcaagaacgaggcgctg
ccttctgacgctcctaaacaccagatcacagtcgtgggcgccacctcaggcgacaccggt
agctcggccatatacggtctccgcggcaaggagaacgtcgaggtgttcatcctcttcccc
gagggtcgtgtgagcgccattcagcagcgacagatgactactgtattggaccagaacatc
cacaacgtggctgtgaagggcacgttcgacgactgccaggctatcgtcaaggaccttttt
gccaacgctgacttcaaggccaagtacaacctaggtgccgtcaactcgattaactttgcg
cgtatcttggcgcagatcgtgtactacgtctgggcctacttccgtgctcacgacgagggt
gttagcggcgaggttgccttctccgtcccaacaggcaacttcggtgacatccttgccggt
ttctacgccaagaagctcggtgttcccattggcaagctgattgtggctaccaacgagaac
gatatcctgcaccgctttttctccacaggaaaataccaccgccgcgacatcgagcacacg
atttccccgtccatggacatttgcgtgtcgagtaactttgaacgttatctcttcgctctg
tccggcgagaaccacgacattctacgcggctggatgcaggctttcgagcagactaatgag
ctcacgatctcgggcgagctgctctccaaggcacaagacgagatggcatcgtatgcggtg
cttcaggagcaggtgcgctccactattgcggagtacaaaacgatgcatcagtacctcttc
gacccgcacagcgctattggcgcagcagctgccatgcactttgtccaggataaccttgca
gacaagccaaactcggcggtagttgtagtcggcactgcccactacggcaagttcctcccc
gtggtgtcgaaggcactaggtgtcgctgagtcagagattgagcaacacccgatcctcaag
gcgctggaatcactgcccacccggctttccgttgccagcaactcgagtgaaactgtggct
gagcatattcgcaagattattgctgagaagaacgacgaagcctgtagtgattga

DBGET integrated database retrieval system