KEGG   Phytophthora infestans: PITG_13305Help
Entry
PITG_13305        CDS       T01333                                 

Definition
aldose 1-epimerase, putative
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pif  Phytophthora infestans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_13305
Enzymes [BR:pif01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PITG_13305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 300 aa AA seqDB search
MSAAKKSVIELRHPSGSRAEVHLYGATVTSFYAAQEPERNVLFLSSKALLDGSKPIRGGI
PLVFPVFGAAEGFPNHGFARVNNWKLSQLDQTVGDDNSPTVATFALDISSEMKAMYPHDF
GLVYEVKLFANALATAIHIQNKSESEIAFQALLHTYLSADDVRDGGVVVEGLKGLTYHDK
VAGQEKSEERDVLTFDQETDSVYANALSPVIVRIKRAVGQEQVVTIEKEAFIKSGATHTA
QQSDVVVWNPWIDKAKGMSDFGDDEYPTMLCVEPGRVSEQQKLPAGQTFTLQQAIKLSAL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgccaaaaagtccgtcatcgagctgcgccacccgtcgggttcacgtgccgag
gtgcatctgtacggcgcgacagtcacttctttctacgcggcacaggagcctgagcgtaat
gtgcttttcctgtcgtcaaaggcgctgctagacggcagcaaaccaatccgcggcggaatt
ccgcttgtgttccctgtctttggcgccgctgagggattccccaaccacggcttcgctcgt
gtcaataactggaaattgagccagctggatcagaccgtgggcgacgacaacagccccaca
gtcgccacttttgcgcttgatatctcgtcggagatgaaggccatgtacccgcacgacttt
ggactcgtgtatgaggtcaaactcttcgcaaatgcgctcgctacagctatccacatccag
aacaaatcggagagcgagatcgccttccaggcgctacttcatacgtatttgtcggcggac
gatgtgcgtgacggaggcgtcgtggtcgagggcctcaagggcctcacgtaccacgacaag
gtcgcgggccaggaaaagagtgaggagcgcgacgtgttgaccttcgaccaggagacggat
agtgtctacgctaacgccctgtcacccgtcattgtgcgcatcaagcgcgcagtcggccag
gaacaagtcgtgaccattgagaaggaggcattcattaagagcggcgccacacacacggca
cagcaaagcgacgtggtcgtgtggaacccgtggatcgacaaggccaagggaatgagcgac
tttggagatgacgagtaccccaccatgctctgcgtcgagcctggtcgcgtcagcgaacag
cagaaacttccggctggacaaaccttcacgctgcagcaggccatcaagctgtcagcactg
tag

DBGET integrated database retrieval system