KEGG   Phytophthora infestans: PITG_13315Help
Entry
PITG_13315        CDS       T01333                                 

Definition
cGMP-dependent protein kinase, putative
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     PITG_13315
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   PITG_13315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 766 aa AA seqDB search
MGGGVSKSEYERIRKELIVKDQVIRTLQERLENGGHVGPMHALPGITNTGDELVTPERTT
MVVKPRNKDKDRVSAAEPTSGPKLEKVGSFSTRFTLLHEAKELLGEGINQPDAEAKSRYN
STDRGTPDSPDGGAQHTGTLTSKGKLRRVEVSAEVMPSRKIMSTKERVVYPKGESSRQLL
LKILQSNVLFQGQSHGEIRDCLDAFFPMRVEPGHLVIKQGAQGDNFYAVESGQLEILVSM
GGSTPIRYGFLGPGLGFGELALLYNMPRAATIRAVTEVELWALERNTFREILASHKLNRL
TRTLEVLQKIAILSKLTSSEMQQVAAAMEWEEFEENDAIVRQGEVGEKFYIINKGEIIVT
QVDANAEEENVIRRLKAGDHFGEMALFKDEMRSATCTAVTRVQCVTLERAHFIAMLGTLQ
ELMDRAPAHLETRDLPHRRASTEALVEPADYKYYMEIPREELEVLQTLGRGAFGRVRLVR
HAASNRAYALKCLIKSHIVENNLKEHVLNEKRVMLALDHPFILKLYTTFKDRTHIYFLVE
LALGGELFTYLRRRDHFEEPVARFYIASVVLVFQHMHSKSIVYRDLKPENILLDNEGYMK
LADFGLAKLVMDRTWTLCGTPDYLAPEIILNKGHDKAVDYWALGILIFELMTGSAPFYAQ
DPMQIYALIIQGNVKFPAYMGRASVDLVQKLLCQNPARRLGNMKHGIKDIINHRWFSSFQ
WDSLKTKSMKPPIVPQVRDDFDTSNFEDFRHEVEDPGHECDWDPDF
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgggaggtggcgtgtccaagagcgagtatgaacgcatccgcaaggaattgatagtgaag
gaccaggtcatccgcacgctgcaggaacgactggaaaatggcgggcacgttggcccaatg
catgccttacctgggataactaatactggggacgagttggtaactccagaacgcacgacc
atggtggtgaagccgcggaacaaggacaaagatcgagtgtcggcagccgaaccaacatcg
ggaccgaaacttgaaaaagttggtagcttcagcactcgattcacattgcttcatgaggca
aaggaactgctgggagaaggcattaaccaaccggacgccgaagctaaaagccgatacaac
tcgactgaccgaggtacaccggacagccctgatggtggagcgcagcatactggtacttta
acttcaaagggcaagctgcggcgtgtcgaggtgagtgctgaagtcatgcctagtcgcaag
atcatgtcgacaaaggagcgtgtagtgtatccaaaaggagagagctccagacagcttctg
ctcaagatattgcagtcaaacgtcctgttccaagggcagtcacatggcgaaattcgtgac
tgcttggacgccttcttcccgatgcgagtcgaacccggtcatttggtcataaagcaagga
gcgcaaggtgataatttttatgcggtggagagcggacagctggagattcttgtttcaatg
ggtggatctacaccgattcggtatggcttcctgggtccaggccttggctttggagagctg
gcactgctgtacaatatgccacgagcagctacgattcgtgccgtgactgaagtggagcta
tgggctcttgagcgtaacacttttcgtgaaattctagcctcgcacaagctcaatcgtctt
actcgaacgcttgaggtattgcaaaaaatcgccatcctaagcaaactcacgtcgtccgaa
atgcagcaagtagccgcagcgatggagtgggaagagtttgaggagaacgatgcgatagtg
cggcagggagaggtgggtgaaaagttctacattatcaacaagggcgagatcatagtcacc
caagtggacgctaatgctgaagaggaaaatgttattcgaaggttaaaagctggtgaccat
ttcggcgagatggcgctttttaaggacgaaatgagatctgccacctgcacggcagtgacg
agagtgcagtgcgttacactggagcgtgctcacttcattgcaatgctaggaactctccag
gagcttatggaccgagcgccagcccacctggagacacgagatctcccacatagacgagca
tcaactgaggcgctggtggaacctgctgactacaagtactacatggaaattccgcgagaa
gaattggaagtacttcagacacttggacgaggtgcttttggtcgcgtccgacttgtgcgc
cacgcagcttccaaccgcgcgtacgctctgaaatgcttgatcaagtcacatatcgtagag
aacaatctgaaggagcacgtgctgaacgaaaagcgggtaatgcttgcactcgatcacccg
tttattctgaagctctacacaacctttaaagatcgaacgcacatttacttcctggtagaa
ctggcgctgggtggggagcttttcacatatctacgtcgaagggaccacttcgaggagccc
gtggctcgtttctacattgctagcgtcgtgcttgtctttcaacatatgcactcaaagagc
atcgtgtatcgagatctaaagcctgaaaacatccttctggataacgaaggttatatgaaa
ctcgcagattttggactagccaagcttgtgatggaccgcacttggacgctgtgcggtaca
cccgattacctcgcacccgagattatcttaaacaagggccatgataaggcagtcgactac
tgggctttgggtatcctcatcttcgagctaatgacgggctctgctccattctacgcccaa
gacccgatgcagatctacgctcttattatccagggtaacgtcaagttcccagcctatatg
ggccgagctagtgttgacctcgtgcaaaagttgctgtgtcagaacccagcacgacgactg
ggaaacatgaagcacgggatcaaagatatcatcaaccaccgctggttctcaagcttccag
tgggacagtctgaaaacgaagagcatgaagcccccgatcgtaccacaggtccgtgatgat
tttgacacatctaacttcgaggactttcgccatgaagttgaggatcctggtcacgagtgt
gattgggatcctgacttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system