KEGG   Phytophthora infestans: PITG_13399Help
Entry
PITG_13399        CDS       T01333                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pif  Phytophthora infestans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pif00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 563 aa AA seqDB search
MCGIVAILRSMMPEAELRQAALVAGKKIQHRGPDWNGVRVFGERGIAIEHERLAIIDPES
GAQPLVSNDPERSITCGVNGEIYNYKELAAGLKTPYKFLTKSDCEVIIPLYLEHGPGFVH
LLRGMFSFVLYDHRKDFFLAARDHMGITPMYYGYGADGSVWFASEMKALEEGCVRFEVFP
PGHVFTSDTETCKPWYKPNWYEPGHIGKTPLDLTALREAFEAAVKRRMMSDVPWGVLLSG
GLDSSLVASIAVREKQKLVAQGGEWINKIHSFTIGLENSPDLKAAQEVAEFLGTIHHSYT
YTIQEGLDAVSEVIKHLETYDVTTIRASTPMFLMSRKIKAMGIKMVLSGEGADEVFGGYL
YFHKAPSAEAFHKETVAKLQALHQYDCLRANKSTSAWGLEARVPFLDADFLDIAMNIDTR
EKMIDAKAKKFEKYIIRKAFEDKENPYLPEHILWRQKEQFSDGVGYGWIDSLKDLAEKTV
TERQMKHAERLFPYNTPQSKEAYMYRSIFQHHFHREVAAQTVPGGPSIACSTPAAIEWDA
AFKNAADPSGRAIAGVHVDAYAE
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtcgccatcctacgctccatgatgcccgaggcggagctccgccaagcc
gcactagtcgccggcaagaagatccagcaccgtggcccggactggaacggcgtgcgcgtg
tttggcgagcgcggtatcgccatcgagcacgagcgtctggccattatcgacccggagtcg
ggcgctcagcctctcgtgagcaacgacccggagcgaagcatcacgtgcggcgtcaacggc
gagatctacaactacaaggagctggctgcgggcctgaaaacgccctacaagttcctcacc
aagtcggactgcgaggtcatcatcccgctctacctcgagcacggcccaggctttgtccac
ttgctgcgtggcatgttcagcttcgttctctacgaccaccgcaaggatttcttcctagct
gctagggatcacatgggaattaccccaatgtattatggctacggagctgacggtagtgtc
tggttcgcctcggaaatgaaggcgctggaggaaggatgcgtccgcttcgaggtcttcccg
cctggtcacgtcttcacgagcgacacggagacgtgtaagccatggtacaagcccaactgg
tacgagcctggccacattggcaagacgccgttggatctcacggctcttcgtgaagctttc
gaggctgctgtcaagcgtcgaatgatgtcggacgtcccatggggcgtactgctctctgga
ggactggactcgtctcttgtggcttcaattgcagtccgagagaagcagaaactcgtggct
caaggtggagaatggatcaacaagatccactcgttcactatcggtctcgagaactcgccc
gacctcaaggcagcacaggaagtggccgagttccttggtaccatccaccactcgtacacg
tacacgatccaggaaggtctggacgctgtatcggaagtcatcaagcacctggagacgtac
gacgtgaccacaatccgtgcgtctacccccatgttccttatgtcgaggaagatcaaggcg
atgggcatcaagatggtgctatctggtgaaggtgccgatgaagtctttggcggatacttg
tacttccacaaagctcccagtgctgaggccttccacaaggagacggtggccaaactacag
gcgctgcaccagtacgactgtctgcgtgccaacaagtccacaagtgcgtggggtctagag
gcgcgtgtgccgttcctggacgccgatttcctcgacatcgccatgaacattgacacgcgc
gagaagatgatcgacgccaaggccaaaaagttcgagaagtacattatccgcaaggctttc
gaggacaaggagaacccgtacttgcccgagcacattctgtggcgtcagaaggagcagttc
tcggacggtgtaggctacgggtggattgattcgctcaaggatctggccgagaagaccgtc
acggagcgccagatgaagcacgccgagcggctattcccgtacaacacgcctcagtccaag
gaggcgtacatgtaccgcagcatcttccagcaccacttccatcgcgaggtggcggcccag
actgtgcctggaggccccagcatcgcctgcagtacccctgctgctatcgagtgggacgct
gcgttcaagaacgccgctgacccgtccggtcgtgccattgccggcgtgcacgtggatgcc
tacgccgagtaa

DBGET integrated database retrieval system