KEGG   Phytophthora infestans: PITG_13431Help
Entry
PITG_13431        CDS       T01333                                 

Definition
WD domain-containing protein, putative
Orthology
K14298  
mRNA export factor
Organism
pif  Phytophthora infestans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pif00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PITG_13431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 350 aa AA seqDB search
MSFGQPAQAGGYLNPNNDYTIGETINDGIQDLAWSPTSNVLVSGSWDNYVRCWEVQQQGT
QFNAVAKAQIAHEGPVLCTAFSGDGSTVFSGSCDKTAKMWVLNGPAQGQQIAAHDAPIRS
IAAIQEANCVATGSWDKTLKYWDTRSPTPMASVQLSERCYAMDAKHPLLVVATADRQVHI
FDIRKPSQIYKSIQSNLKFQTRTISCFPDASGFAIGSIEGRCAIQHVEDKDKRNDFAFKC
HRDGSDIYPVSSIAFHPFGTFSTTGGDGTFCFWDKDARQKLKTFNKCNQSITTGKFNARG
DIFAYTLSYDWSMGAEKYNPSQPSVIRLHSVAEAEIKQKKKPGTGSRNSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcggacagccagcgcaggccggcgggtacctgaacccgaacaacgactacact
atcggtgagaccattaacgatggtatccaggacctggcctggagtccaacgagcaacgtg
ctggtgtcgggcagctgggacaactacgtgcgttgctgggaagtgcagcaacaagggacc
cagttcaatgccgttgccaaggcgcagattgcacacgagggtcccgtcctctgcacggct
ttcagtggggatggcagcacagtgttttcaggatcgtgtgataagacagcgaaaatgtgg
gtgctcaacggacctgcgcagggccagcaaattgccgcgcacgacgcaccgatccgcagc
atcgctgccattcaggaggccaactgcgtagccacaggtagctgggataagacgcttaaa
tactgggacacgcggtcccccacgcccatggcctcagtgcagctctcggagcggtgctat
gccatggatgctaagcacccgctgcttgttgtggccacagccgaccgccaagtgcacatt
tttgacattcgcaaaccgtcgcagatttacaagtcgattcagtcgaacctcaagttccag
acgcgaacgatttcgtgcttcccggatgcttcgggtttcgcgattggatcgatcgaagga
cgttgcgcaattcagcacgttgaggataaggacaagaggaacgactttgcgtttaagtgc
caccgcgacggatcggatatttaccccgtgagcagcatcgcgtttcatccattcggtacg
ttctctacgacaggcggagacggcacattctgcttctgggacaaagatgctcggcagaag
ctcaaaactttcaacaaatgcaaccagtcgatcacaaccggcaaattcaacgctcgtggc
gatatctttgcctacacgctgtcgtacgactggtccatgggtgcggagaaatacaatccg
agtcagccgagcgtcattcggctgcacagcgtggcggaggccgaaatcaagcagaagaaa
aagccaggtactgggtcgcggaattcgttctag

DBGET integrated database retrieval system