KEGG   Phytophthora infestans: PITG_13546Help
Entry
PITG_13546        CDS       T01333                                 

Definition
sphingosine kinase, putative
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pif  Phytophthora infestans
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PITG_13546
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     PITG_13546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 501 aa AA seqDB search
MSPSEPAAAHDPARFRLSPSHCVVASAGKKQQTLELPWGDVLGAHVLTSDGELVQSPVDV
QSDAKFLFGVFACVCKSHKPKTMKKRRVEEFFFRFKGQQMPQVLKLQQLVNFVADPRNQE
TVEKLESLDQLEVVARPQRKFLVLINPVSGPGRARQIYDSKVAPVLRFANVETDVKVMDH
ANHAMEIVSEIPLGVYDCVVAVGGDGSLYEIVQGLMKRADWNEAIRQPIGIIPGGSGNGL
AHSIAHQSEEKGKPVNAAFILAKGLPHDLDITSVRNDKDTTYSFLSLEWASIADVDIGSE
KLRMLGGLRFTVAFINQLVLKRPEYPGKIWYLDEGEDAKPQRYFETHDPKSTQRPAMDLF
DGEGQGPKETEDSEAKWKQLDGHFRIVWVMNVSHAASDALIAPGAEFDDGYNYITFMDGA
HSRKDLLAMMLAIESGDHMDKKGVQQVRTRAFKLVPERATDLMCVDGEVVEGPYLEAQVH
RGMARIMAVPRWQNREEVALR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgtcggagcctgctgccgcccacgaccccgctcgcttccgcctctcaccatcg
cactgcgtggttgcatccgccggcaagaagcagcagacgctagaactgccgtggggcgat
gtactgggcgcccacgtcctcacatcggacggggaactcgtccagagccctgtggacgtg
cagagcgacgcaaaattccttttcggcgtcttcgcctgcgtgtgcaagagccacaagccc
aaaacgatgaaaaagcggcgcgtcgaggagtttttcttccgattcaaaggacaacagatg
ccgcaagtgctaaaactgcagcaactcgtcaactttgtggccgatccgaggaaccaggag
actgtcgagaaactggaaagtctggaccagctggaggtcgtggcgcgaccgcaacgcaag
ttcctggtgctcataaaccccgtgagcggaccaggacgagcgcggcagatctacgacagc
aaagtggcgcctgtgctccgcttcgccaacgtggagacggacgtgaaggtcatggaccac
gccaaccacgcgatggagatcgtctcggagataccgctgggtgtctacgactgcgtcgtg
gccgtcggtggcgacggcagtctgtacgaaattgtccagggtctgatgaagcgcgcggac
tggaacgaggcgatccgacagccaatcggcatcatcccgggcggctccggcaacggtctg
gcccactctatcgcgcaccagagtgaggagaagggcaagcccgtgaacgctgccttcatc
ctggccaaaggtttaccgcacgacttggacatcacgtcggtgcgcaatgacaaggacacg
acgtactcgtttctgtcgctggagtgggcgtccattgccgatgtggatattggctcggag
aagctgcggatgttgggaggactgcgctttaccgtcgcctttatcaaccaattggtgtta
aaacgaccggaatatccagggaaaatctggtatctggacgaaggcgaggacgcaaagcct
caacgttacttcgagacgcacgatccaaagtcgacacaacgtccagcaatggatttattc
gatggagaaggtcaaggtccgaaggagacggaagactcggaggccaagtggaagcagctg
gacggacatttccgtatcgtctgggtcatgaacgtctcgcacgcagcttccgacgcgctg
attgcccccggtgccgagtttgatgatggctacaactacatcacgttcatggacggcgct
cactcccgcaaggatctgctggcgatgatgctcgcgattgagagtggtgaccacatggac
aagaaaggggtgcaacaggtgcgcacgcgagcgttcaagctcgttcctgagcgagccacc
gacctcatgtgcgtggacggagaagtggtggaaggcccgtatcttgaggctcaagtccac
cgaggcatggctcgcattatggccgtccctcgctggcagaatagggaggaagtggcactg
cgttaa

DBGET integrated database retrieval system