KEGG   Phytophthora infestans: PITG_13749Help
Entry
PITG_13749        CDS       T01333                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pif  Phytophthora infestans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PITG_13749
   01230 Biosynthesis of amino acids
    PITG_13749
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_13749
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PITG_13749
Enzymes [BR:pif01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PITG_13749
Exosome [BR:pif04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PITG_13749
  Exosomal proteins of melanoma cells
   PITG_13749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 287 aa AA seqDB search
MVLALRRSLAISSRVANRSLGMLHQQQKAMKHTHTLVLIRHGESEWNKKNLFTGWYDVQL
SEKGNKEAAAAGQLLKKEGYTFDVAYTSYLKRAIRTLWHVLEQSDQMWIPVFKTWRLNER
HYGALTGLDKQATVEKHGAEKVLEWRRSYNIPPPNLDTSSEYYPGNDVRYKDVPKADLPL
AESLELTAARVLPEWERTIVPSIKSGKNVVVAAHGNSLRALVKHLDNISEDEITGLNIPT
GVPLVYHLDENLKPIPHKDGIAPLSAFYLGDQDEIRARILGVKNQTK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggttctcgctctacgtcgctcgctcgccatctcctcacgcgtggccaaccgctcgttg
ggtatgttgcatcagcagcagaaggccatgaagcacacgcacacgctggtgctgatccgt
cacggagagagtgagtggaacaagaagaacctctttacgggatggtacgacgtgcagctc
tctgaaaagggcaataaggaggccgccgctgctggtcaactgcttaagaaggagggatac
acgttcgatgtcgcctatacgtcgtaccttaaacgtgcgatccgtacgctgtggcatgtt
ctagaacaaagcgaccaaatgtggatccctgtgttcaagacgtggcgtcttaatgaacgc
cactatggcgcgcttactggactagacaaacaggctacggtggagaagcatggcgctgag
aaagtgttagagtggagacgtagctacaacattccgcctccgaaccttgacacgtctagc
gagtactacccaggcaacgacgtccggtacaaggacgtccctaaggcggatctgcctctg
gccgagtctctggagctcacggccgcccgcgtactacctgagtgggagcgcaccattgtg
cccagcatcaagtcgggcaagaacgtggtggtcgccgcccacggcaacagtctgcgtgct
cttgtcaagcacctggacaacatctcggaggacgagatcacgggtctcaacatccccacg
ggcgttccgctcgtctaccacctggacgagaacctcaagcccatcccgcacaaggacggt
atcgcacctcttagcgccttctacctgggcgatcaggacgagatccgtgctcgtatcctc
ggtgttaagaaccagaccaagtaa

DBGET integrated database retrieval system