KEGG   Phytophthora infestans: PITG_13832Help
Entry
PITG_13832        CDS       T01333                                 

Definition
delta-aminolevulinic acid dehydratase, putative
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pif  Phytophthora infestans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pif00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 327 aa AA seqDB search
MNFLHSSLHHPAQRSWSEPHLHPSQLMYPLFVTLRSEDKAIRGLEPELQWGQGPDGDYAS
LVAHLRDLMTKGLTNVMLFGVVEDKDARGCMADDEATPVIKCTKALRKALPDLMVACDVC
MCEYTDNGHCGILREVNGEQVLDNERTLERLASIALAYAKAGAHMVCPSDMMDNRIGAIR
KIYNEHGFEHVSIMAYTSKKASVMYAPFRDAVESTFQGDRKRYQHPVGSTSHAALAFERD
VQQGADSVIVKPSLFYSDIVASFAAKKTVPVVCYLVSGEYKMVKDYGDSTNSLEAVVREA
HLGLLRAGASVLITYFTPYILDHCAKW
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcctgcactccagcctgcatcaccctgcacagcgctcctggagcgagccacac
ctgcacccgtcgcagctcatgtacccgctgtttgtgacgctgcgcagcgaggacaaggcg
atccgtgggcttgagccggagctgcagtggggtcagggccctgacggtgactacgcctcg
cttgtggcccatttgcgtgacctcatgaccaagggtctgactaacgtgatgctctttggc
gtcgtggaggacaaggatgcacggggctgcatggcggacgacgaggccacgcccgtcatc
aagtgtaccaaggcgctgcgcaaggcactgcccgatctcatggtggcctgcgatgtctgc
atgtgtgagtacacggataatggccactgcggtatcctgcgtgaagtaaatggcgagcaa
gtgctggacaacgagcgtacactcgagcggctcgccagcatagcacttgcctacgctaag
gcaggcgcgcacatggtatgcccgtccgacatgatggacaatcgcatcggcgctatccgc
aagatctacaatgagcacggctttgagcacgtgtccatcatggcctacacgtccaagaag
gcctctgtcatgtacgcgcccttccgcgacgctgtcgagtccacgttccagggtgatcgc
aagcgctatcagcaccccgtgggcagcacgagccatgccgcgttagccttcgagcgcgac
gtgcagcagggtgctgacagcgtcatcgtcaagccatcgctcttctactctgatatcgtg
gccagctttgccgctaagaagaccgtgcctgtagtgtgctacctcgtctcaggcgagtac
aagatggtcaaggactacggtgactccaccaactcactcgaagctgtggtgcgcgaggcc
caccttggtctgctccgtgccggcgccagcgtgctaatcacgtacttcaccccgtacatc
ttggaccactgcgctaagtggtaa

DBGET integrated database retrieval system