KEGG   Phytophthora infestans: PITG_14626Help
Entry
PITG_14626        CDS       T01333                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase, putative
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
pif  Phytophthora infestans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 584 aa AA seqDB search
MDASRSARPARRAQRLLPALTPAPPSSGSATASQKWEQIQQPTDSNSAPIGKKSSSIAHI
FFNRRPLDLIRRTTSSLLATSGNSEPSSVVVTPPVTEERKFWQPHRPLGDKSGRRRLQQL
QHKEKGNRPQPQRRLRLSEDAETEQRKQHEQDTRTETATEICPPTGQQFLMDTEKAAELT
ALERAEILQCDEIRFVSTLAVKRNRRNGKIQNDLPIHGDEAAAHVEEESDDFPTCTELCN
DGYDDERGDYLVLIGDHLAFRYEVLSALGQGSFGQVVCCLDHRTGKQVAVKIIRNRRKYR
DQALVEVELLTQLQRSGDNAHIVRMEEYFQFRDHVCIAFEVLGINLYDFLKLRHFHGLPM
RSVRTIGKQLAQSLAFLKQEQIVHCDLKPENILLDTTTIPGDNGIVDNVTLIDFGSSCLE
GAPMFTYIQSRFYRSPEVLLGHMYSGAIDMWSFACILVELHAGHPIFAGENEREQFACIM
EVLDVPPIEIVRNSKRRLNFFDEVANPADINTVDYTPKAFVNSRGRRRSPGSRSLVGAVK
SDDPEFLAFLAKCFVWDPSQRLTPEQALQEPWILHHVNPVEYEL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctctcgctcggcgcgtccggctcggcgagcgcagcgcctgttgccggcgctc
acaccagcgccgcccagctccggctcagctacagcttcacagaaatgggaacagatccag
cagcccactgacagcaacagcgcgccaatcggaaagaaatcatcctctatagcccacatt
ttcttcaaccgacgaccattagacttgattcgtcgaactaccagctctttattagccacc
agtggcaactccgagccctcgagtgtcgtcgtgacaccgccggtcaccgaagagcgcaag
ttctggcagccacatcgtcctctcggcgacaagagcgggcgacggagactgcaacaacta
caacacaaagagaaaggcaacagaccgcagccgcaacgaagactgcgactcagtgaagat
gccgaaacagagcagaggaagcaacacgagcaagacactcgaacagaaacagcaacagag
atatgtcctccgactggccaacagttcttgatggatacagaaaaagcagcggagctcacg
gcgctggagcgggcggagatcttacagtgcgacgagatccgcttcgtgtcgacacttgca
gtcaagcgcaatcgccgcaatggcaagatccagaacgatctgccaatacacggagacgag
gcggcagctcacgttgaagaggaatcagacgactttcctacatgtaccgaattatgcaac
gacggctacgatgacgagcgcggagactacttggtcttgataggagaccacttagccttc
cgatacgaagtactgagtgcattaggtcaaggatcgttcggccaggtggtgtgttgtctg
gatcatcgcactggcaaacaggtcgctgtcaagatcattcgtaatcgacggaaataccgc
gaccaggctctcgtggaggtggaacttttgacacaactccaacgtagtggcgacaacgcg
cacattgtgcgcatggaggaatatttccagttccgtgaccacgtgtgcatcgccttcgag
gtgctgggcatcaacttgtacgatttcctcaagttgcgtcacttccacggtctccccatg
cgcagtgtacgcacaattggcaagcaattggcccaatctctggcattcctcaaacaggag
cagatcgtccactgcgacctcaaacctgagaatattctgctagatacgacgactatacca
ggagataatggcatcgtggacaacgtgacactcatcgacttcggcagtagttgtctggaa
ggagctcccatgttcacctacatccagagtcgcttctatcgcagtccagaagttttgctt
ggccacatgtactctggtgctatcgacatgtggagttttgcctgtatcctagtcgagttg
cacgcgggtcatccgatttttgccggtgagaacgagcgcgaacagtttgcctgtatcatg
gaggtgctggatgtgcctccaattgaaatagtgcgcaatagcaagcgacggctaaacttt
ttcgatgaagtggccaacccggcggatatcaacactgtggactacacacccaaagcgttc
gtgaactcacgtggtcgtcgacgctcgccgggatcgcgaagtcttgtcggcgctgtcaag
tctgatgatccggaatttttggcctttttggcaaaatgtttcgtttgggatccaagtcaa
cgtctcactcctgaacaagctcttcaggaaccttggatacttcaccacgtcaaccctgta
gaatatgagttataa

DBGET integrated database retrieval system