KEGG   Phytophthora infestans: PITG_14707Help
Entry
PITG_14707        CDS       T01333                                 

Definition
SNF1-related protein kinase catalytic subunit alpha, putative
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
pif  Phytophthora infestans
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:pif00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    PITG_14707
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PITG_14707
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   PITG_14707
Mitochondrial biogenesis [BR:pif03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    PITG_14707
  Mitophagy factors
   Other mitophagy factors
    PITG_14707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 572 aa AA seqDB search
MSDIPIQLGHYRLGKTLGIGSFGKVKLAEHDITGHKVAIKILNRNKIRSLDMSEKVRREI
TLLRKMRHPHIIRLYEVIDTPTDIFMVLEYIAGGELFDYIVSKGRLAPEEARHFFHQIIS
GVEYCHFHRIVHRDLKPENLLLDADNNIKIADFGLSNSMEDGDFLRTSCGSPNYAAPEVI
SGSLYAGPEVDVWSCGVILYALLCGSLPFDDESIPNLFKKIRGGMYSLPSHLSEMARDLI
PRMLVVDPMKRITIPEIRQHPWFQIDLPPYLQHPPEIVENQTFKIDDECLSQCLALSYAA
NIGHDQLVALLMRRENHPLRVAYELILDHKNAKIRIDELRDVRTVNNKPKTFSTPEPSTL
LLPGRGPLPMAASPLITPSSALQDPRNFGGRGISIPGQAPRMSTGGNGMPGFDDGHGGAA
PTPKRRRWYLGIQSKKEPAHVMSEVYKALFVLHFEWKVVAPYRVKCRWQSPAGDPNGGAV
MNAEDAKLQQQMQRIKIGLQLYKVQQHIYLLDFQRLDGNAFTYMNLCARIITELKTLSGI
RPLASGHDPRFGDGNMNSVHLHQHNPHAQGAQ
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattcccattcagttgggccactatcggctgggcaagacgctcggcatcggc
tcattcggcaaagtaaagttggccgaacatgacatcacaggccacaaagtagccatcaag
atcctcaaccgcaacaagatccgcagcctcgacatgagcgaaaaggtgcgacgcgagatc
acactgttgcgtaagatgcgccatccacacattatccgcctatacgaggtgatcgacacg
cccacggacatcttcatggtgctcgagtacattgcaggcggagagctcttcgattacatc
gtgtctaaaggccgattggctccagaagaagcgcgacatttcttccaccagatcatctcg
ggagtggaatattgccatttccaccgtatcgtacaccgagacctgaagcccgaaaacttg
ctgctagacgcagacaataacatcaagatcgcagacttcggactgtccaatagcatggaa
gatggagatttcctgcgcacgtcgtgtggctctcccaattacgccgcgcccgaggtgatt
tctggcagtctgtatgctggtccagaggtggatgtgtggtcctgtggcgtcattctgtac
gcgctactgtgtggcagtcttccgttcgatgacgagagtatccccaatttgtttaaaaaa
atccgtggcggcatgtactcgctgcccagccacctgtccgagatggcgcgcgacctcatc
ccgcgcatgctcgtggtggaccccatgaagcgtatcacgatcccggagatccgacagcat
ccctggttccaaatcgacctcccaccgtatctgcaacatccacctgaaattgtggaaaac
cagactttcaagattgacgacgagtgcttgtcgcagtgtttggcactgagctacgccgcg
aatatcggacatgaccagctggttgcgttgcttatgagacgagagaatcatccgcttcga
gtggcttacgagctgatcttagatcataagaacgccaagatccgaatcgatgaactacgt
gacgttcggacggtgaataacaagcccaagacgttctcgacacctgagcctagtacgttg
ctattaccagggcgaggacctcttcccatggctgcatcgcccttgatcacgccgtcatca
gcgctccaggatcctcggaatttcggtggtcgtgggattagtattccgggacaagcacct
cgaatgtcaacaggaggcaacggtatgcccggctttgacgacggtcacggcggcgcagct
cctacccccaagcgacgacgatggtacctgggtattcagtcgaaaaaagagcccgctcac
gtcatgtcggaggtgtacaaggcgctgtttgtgctccactttgagtggaaagtcgtggcg
ccgtaccgtgtaaagtgtcgatggcaatcgcctgcaggagaccccaatggaggcgccgtg
atgaacgcggaagacgcgaaactgcaacaacagatgcaacgcatcaagatcggcttgcag
ctgtacaaggtgcagcaacacatctatctcttggacttccagcgtctggatggcaatgcc
ttcacgtacatgaacctctgtgcacgcatcattacggagctcaagacgctctcggggatc
cgaccgctggctagtggccacgacccacgctttggagatggcaacatgaactcggtgcac
ttacaccagcacaatccacacgctcaaggcgctcagtga

DBGET integrated database retrieval system