KEGG   Phytophthora infestans: PITG_14993Help
Entry
PITG_14993        CDS       T01333                                 

Definition
protein-L-isoaspartate O-methyltransferase, putative
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pif  Phytophthora infestans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 239 aa AA seqDB search
MSFWPCNSSSNEGLVSNLKRTNVVRSDAVFNAMVKTDRAKYLAQIETPDGGHVGELAAYQ
DVPHPIGFHQTISAPHMHAHAMELGYAAIKDVRHPRILDVGAGSGYLTACLGRMVEDNGH
VFGLEIVPGLAQFAKKNIQTADGDLVDRGVVSVRCHNGWDGLPNEAPFHYIHVGAAAESP
PQALMDQLADGGRMVLPVDEPRGGQVLVEITRHGTNFSQRRLFGVCYVPLVRERERKLS
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctggccgtgtaactcgtcgagtaatgaaggcttggtcagtaacttgaagcgt
acgaatgtcgtccgctccgacgcggtgttcaacgcgatggtcaagacagaccgtgccaag
tatttggcacagattgagactccggatggaggacatgtgggggaattggcagcgtaccaa
gacgtgcctcaccctatcggcttccaccagactatttcagcgccacatatgcatgcccac
gcgatggaactgggctatgcagcgatcaaggacgtacgtcatccacggattctcgacgtt
ggggctggttcggggtatctaacagcgtgtcttggtcggatggtggaagacaatggacac
gtcttcggactggagatcgttcctggactcgcgcagttcgctaagaagaacatccagaca
gctgacggagacttagtcgaccgaggtgtcgtgtctgtgcgctgccacaatgggtgggac
ggtcttccgaacgaagctccgttccactacatccacgtcggagctgctgctgaatctccg
cctcaggctttgatggaccaactcgcagacggcggacgcatggtgctgcctgtggacgaa
cctcgcggtggccaagtattagtggagatcacaagacatggtaccaacttctcacaacgt
cgattgttcggcgtgtgctacgtgccactcgtccgcgaacgtgaacgcaagctcagctga

DBGET integrated database retrieval system