KEGG   Phytophthora infestans: PITG_15382Help
Entry
PITG_15382        CDS       T01333                                 

Definition
(RefSeq) alpha kinase
  KO
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     PITG_15382
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   PITG_15382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 493 aa AA seqDB search
MSKPPSSNMDARYNDRNAPLAVAVAVPSQQSPFEKLNTLKLLLDCGHLTAGEYQERKTQI
INEMTGTSTERKKPSPSSRRPGSANGSPPPPPLQPLLKTVVPHGPPDFSRIRRERADKLS
FDVDTLEWHSTPVKVKLDLVPFATGQLRNAYYLQELGADGSSSRLLVAKVSLRFAEPSTY
LSDVEMQAVCAHYAALYNEHEPPLKVCYARSWLLKLRNRERGTLVCSVEEFLPGAYVKYS
NNSGYVGRETSTTEERERNTPQAFSHFSFVASDFRLMIVDIQGVADSYTDPQIHSADGRG
FGVGNLGTFGMEKFLESHRCNEVCRWLGLRSINEQYKAGGTAAPGYEMPFGGAIKKSTNR
ITEERNTFSTSVTVSEAFGDTASADWTEQDSKRESAEEDEEDEEDEEDAGEHSDSTSYAT
DSSPAMSALHPRHPRAKRQKRVSPRSPGKPKKREGGRRLRHPTHVSKSITSSPGAGGGSL
WSNVARNLFCGCA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccgccttcaagcaacatggacgcccgctataacgaccggaacgcgccattg
gctgtggctgtggcggttccttcgcaacagagcccctttgagaagctcaacacactcaag
ttgctcttagattgcggccacttaaccgcgggcgagtaccaggaacgcaagacgcagatc
atcaacgagatgacaggaacttccaccgagaggaagaaaccctcaccaagttctaggagg
ccaggctcagccaatggaagtccgccacctccgcctctccagcctttacttaagaccgtc
gtacctcatggtccgccagatttctcaagaattagaagagaacgagcggataaattgagc
ttcgatgtggatacattggagtggcattcgacccccgtgaaggtgaaattggatctggtg
ccgtttgctacgggacaattgagaaatgcctattatctacaggaactcggtgctgatggt
agttcgtcgaggttattggtggcgaaagtgagtctacgttttgctgagcccagtacgtat
ctcagcgacgtggagatgcaagcggtgtgtgctcattacgcagctctatacaacgagcat
gagcctcctctaaaggtgtgttatgcgaggtcttggttactgaaactgaggaatcgagaa
cgcgggactctggtgtgttccgtggaggagttcctgccaggagcgtatgtgaaatatagc
aataacagcggctacgtgggtcgagaaaccagcacgactgaagaacgggaacgcaacacg
ccacaggctttttcccacttttctttcgtggcttcggatttccgattaatgattgtggac
atccaaggagtcgcagatagctacaccgatcctcagattcattccgctgacgggagaggc
tttggggtggggaatctcggtaccttcgggatggaaaagttcctggaaagtcatcgatgc
aatgaagtctgtcggtggctgggactgcgcagtattaacgaacagtacaaagccggcgga
acggctgctcccgggtacgagatgccattcggtggggccattaagaagtcgacgaatagg
attacagaggaacgcaatacattctccacttcagtcacagtgagcgaagcatttggcgac
actgcatcagcagattggaccgagcaggactcgaaacgggagagtgcggaggaggacgaa
gaagatgaagaagacgaagaggacgcgggcgaacactctgactcgacttcgtacgctacg
gactcgtcaccggcaatgtcggcactgcatccacgacatccgagggcgaagaggcaaaag
cgagtttcgcctcgatcacctggcaagccaaaaaaacgcgagggtggtcgacggctccgg
caccccacacatgtcagcaaaagcatcacaagtagtcccggggcaggaggtggaagcctc
tggtcaaatgtggctcgaaatttattctgcgggtgtgcgtga

DBGET integrated database retrieval system