KEGG   Phytophthora infestans: PITG_15408Help
Entry
PITG_15408        CDS       T01333                                 

Definition
phosphatidylinositol kinase (PIK-L1)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pif  Phytophthora infestans
Brite
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   PITG_15408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 3238 aa AA seqDB search
MQFQDREHVEALLASLVQRLDVNDATARATRVSELYAAVASLSRQLSAERFAKALGQLTP
QLYTLLQRASESAQLGALLAIERLIDLSNEDQFIRFVNYVRYFLQQPQTSRRALLAASSA
MGKLATSSVSGTLVASFVDFEAKRAFEWLQESQPGTHAARNEALVSQRRLAACFVLRELA
QAAPTLFHVNLTTFFQSIWGAVRDQKVEIREAATSALAACLQLITKRQTRHRVQWYCKVY
DQVFEGLALRPSASGSSSPSSSNGQSLASWECAHGSLLVIGELIANTGRFMVPRFREVCD
TVLRYKDAKERLVSRAVSRLLPQLAEFCPGAFVQYYLDVCVAHLTKRILEYSAPPSERGV
AFLAMGRLSLAVGDALLPHLPPILKLVKESLAPHTGSKRKRARNKLFCVQTLTCVANMSR
ALGPRFEPFLFQDGVLETMMIGGLSDELIDSLAEVVASVPSALPYVQERLLNEISGILRG
TPFSLGSGGAVYPPGSSGGAGSSTGGDGSELTLDASYYDTATDAPPAKQTAVQALFSSMK
RGFSSAEDDPSTGSGSLMIKGETGDEIDTILLSLRTLSCFDFSGSFCLLPFVRDCVALYL
KNADARIRKQAVITCSKLLLPSPESSDTALMSSWRHVKKRGPSGRVIDLVLTQLLQVGIS
DMDVAVRRSVVESLDARFDELLSQETHLKLVFLLLNDESAIIRERAMQLLERLAPRNPAF
VMPSLRRVIIQLVTELQHTFDLRMREDSTRLLGHLIRGAQHLVDPYVVRILEVLLPILVR
GNAPLTMAVLVTLGELALVSRTQIAAYERYLFPLIIHTLQDHSSIEKRQVALQTLGQLAG
STGCVVRPYLASPKLLEIFLSLLHHNVGSPWSLRREAMRTIGILGALDPYKYKLCISRAS
LRQANEVASTTDTSTTKEETDKNADTAPLGVSKSLAGSVAPQYPTLEIDLKALGVTINLA
SFDRKTTSDALDEKQQIELQLFTAAPIGTRKIDAGTAAGTLGIGSQSSHPVSGAAGVSAG
ASSSSLSSSKKRQIGSIGMSLSDDSFDFESSLMDSELELDPTELSPASEAYFPTVAIHAL
LRILREPSLNAHHHGVIQAIMFIFKSLSTQCVPFLKYILPPFLRVLSRGEPRLRESLFLQ
LTTLISIVNAHMKPFFPPIMVLALRFWGSHLTQIVRLVEKISQAAPHEFRTQYFPKLLPK
LLEVLQPHFGLGGAADGELAGASAGVSGATAITQGSGDSVSVVGGSGDHGQAGDSVSGGS
SDHTSSTYDIVQNGSADGITAVAVAAIQVQVVQALIVFGDAVEDYVYLVVPALVHLMESL
DTPLEVKITTVYALARICVVANFEQYAGPRLLQPLARVASQVSAKGAFFFSRSSSSAAIP
VSGGSSISGSSGSGSSGAAAARIATSKSEATRFSEVMLYALGALVFQLQAEVLSFEPLMQ
QIIASLPFSQRGNLATAVNDAEGGSPSSSPQAMVQRIAQALESLRYGARVPRTFLSDPAF
MTSTLRKFSTELQAQTATSMTPAASPPTSARLHVNQQNLRRAWEASQRSTKEDWLEWMRR
FSIELLRESPSAALRSCCALAQAYNPLARALFNPAFVSCWNELYEQYQDYLVRALETAFQ
SDTIPAEILQTLLNLAEFMEHDVEALPIDIRELGELAQKCHAYAKALHYKELEFHTSPST
CIEALISINNQLGQPEAAVGILKYAQAHHSRVIQVKETWFEKLQDWRAALALYDRRLQFA
QQQGGEDQALDIEVCIGKMRCLEALGMWEELGALATQVWAALRSSERSPSKASGPPPRSR
PLSAGRTASGSAGAGSGRGNPGLLRRGSSNYGSSSSLASAGGPPPSSSYQLGDDRGDEAK
ALRRVAMLGARASWCLSQWDSMTQYVTECAAQNDKSNANSTVISRAANGNGQGYGYGHTH
GHGIFGADEDVTELSLYESVLAVHRGNFDQATTLIDATRKTLDTKLGALVGESYSRAYRS
MVTLQQLSELEEVVTYKKLRAQISKGEEAARYKRHLMRMWRDRLSGCKRVVEVWQQLIAV
RALILSPHEDIDTYLQFASLCRQSGNLSLSLKVFTNALHVHGGSGSNGTGISEMLSVAPS
SSAATSFGFGEKDRNRVAFAYLKHLWAAGQKQEALSDLHRLVVRISSMAKHRSQPPGGMG
GMPSPAPAMMPMRSEEEELLVKCHLKMAEWQLAVHDQQIEHVPVESVLSSLRLCTELEPR
SYKAWHAWALMNFQVVEHSTHSQHISANATASAVAPSASVAPYIAPAIEGFFRSVALGRS
RWAANVQQDILRVLTLWFAHGHRTDVHAALEKGFRSVSIETWLIVIPQLIARIHTPYPRI
QKQLHRLLVAVGKQHPHALIYPLSVALKSSVSERQQAAEAIMSTMRTNYVELVDEALLVS
RELIRVAILWHEMWHEGLEEASRLYFGEHNVDGMAEVLRPLHAMMERGPETLREVSFHGA
FGRDLREANEWLQRFLSNRRNESDLNRAWDLYYHVFRRINKQLPQITTLELQVVSPNLLQ
ARNLQLAVPGTYRAGHALVKIGSFLPTVAVITSKQRPRRITIVGSNGLEYMFLLKGHEDL
RQDERVTQLFGLVNALLINDRNTSKKDLKIHRYPVIPLSDNAGIVGWVPHCDTLHQLIRD
YREARKILLNIEHRLMLQMAPDYDALTLLEKVEVFLYALENTAGQDLYKVLWLKSENSEV
WLDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLHRFTGTIVHIDFGDCFEVAMDREKYP
EKIPFRLTRMLTNAMEVSGIEGNFRFSCESVMAVLRENRHSLMAMLEAFVHDPLINWRLL
SATNVQSSSHAGSSVASSVVSSSMVSSAMSMDSESDYEPSEASSHGQSEYSSDNSSHGPY
DDSSHGPSEASSHGPSEASTHGGEEEATHRRSESISIPDPTPSSTATLLDDRDEPRPNAS
KTQDAPVQDDKQETREETKVYEVDSTEAQQAQQLPPRPVPRQISASLAAPRQLPPRPKEE
PAPPPLPSSLSSRPMSLSKSIPMRKLPPRAPANRLREDAIDENEESNVVEKIDYSTTNLH
AEISSLAASVSSVGHSSLSRSFSVTQAQIQAQSQIRQQRQQADKGQSTQAPSTPLGPPPR
MAPAASTSFVSVTAAAHIPPSSDTVPPSVANNDLHANRSVRERELLSALGPEGIAAPRVA
LNEKAVAVIRRVQAKLSGRDFEGDGEPLDVSAQVQRLISQATSHENLCQCYIGWCPFW
NT seq 9717 nt NT seq  +upstreamnt  +downstreamnt
atgcagttccaagaccgggagcacgtcgaggcgctgctcgcctctctggtgcagcgtctg
gacgtcaacgacgctaccgcccgtgcaacgcgtgtctcggagctgtatgcagccgttgcg
tcgctcagccggcagttgtcggccgagcgcttcgccaaggccctgggccagctcaccccg
cagctctacactctgcttcaacgtgcctccgagagcgcgcaattgggtgcactgctggcc
atcgagcgcctcatcgacctgtctaatgaggaccaattcatccgcttcgtcaactatgtg
aggtacttcttacagcagcctcaaaccagcaggagagcgctgctggcggcctcctcagcc
atggggaagcttgcaacctccagtgtcagtgggacgctggtggcaagctttgtggacttc
gaggccaagcgagccttcgagtggcttcaagagagccaaccaggcactcacgcagccagg
aatgaggctctggtaagccaacggagactggcggcgtgcttcgtgctgcgtgaactggct
caagcggctcccacactgttccacgtgaacttaaccacgttcttccagagtatctggggc
gctgtgagagaccagaaggtcgagatcagagaggccgcaaccagtgcgttggctgcgtgt
ttacagctcattaccaagagacagacccgacacagagtgcagtggtattgcaaggtgtac
gaccaagtgtttgaaggcttggctctgcgtcccagtgcttcaggatcgagctctccgtcc
tcgagtaatggccaatcgctggcctcctgggagtgcgcgcacggatctttactcgtgatc
ggagagctgatcgccaacacggggcgattcatggtgccgagattccgagaagtgtgcgat
acggtgctgagatacaaagacgccaaggagcgactagtgagtcgtgctgtctcgaggctg
ctaccgcagctggcggagttttgtcctggagcgttcgtgcaatactatctggatgtgtgt
gtggcacatttgaccaagcggatcttggagtactcagcgccgccgtcggagcgtggcgtg
gcgttcttagccatgggcagactgtcgttggctgtaggtgatgcgctgctgccgcatctc
ccgcctattctcaagttggtgaaggagtcgctagcgccacacacgggatcgaagcgcaaa
cgagctcgcaacaagctcttctgtgtccaaacgctcacttgtgtagccaatatgtcgcga
gctttaggaccacgattcgagccctttttgttccaggacggagtgctggagacgatgatg
attggtggacttagcgacgagctgattgattctcttgctgaggttgtcgctagtgtgcca
agtgcgctcccgtatgttcaagagcgattgctaaacgagatctcggggatcttgcgtggc
actccattctcgctaggtagcggtggagcggtgtatccacctgggagtagtggcggggct
ggcagttctaccggcggcgacggcagcgagttgactctggatgcgtcatactacgacact
gccactgacgctcctcccgctaagcagacggccgtccaggctctgttttcgtcgatgaag
cgaggcttctccagtgctgaggatgatccgtccactggcagtggctcgttgatgatcaag
ggcgagacgggcgacgagattgatacgatcttgttgtctttacgtacgttgagctgcttc
gatttcagtggcagcttctgtctcctgccatttgtacgcgactgcgttgcgctgtatctg
aagaacgcggacgcacgtattcgcaaacaggcagtgatcacgtgcagtaaactgctgctg
ccttcacctgaatcttcggataccgcgctcatgtcttcgtggcgacacgtcaagaagcga
ggaccaagtggacgagtgattgatctcgtgcttacacagctgcttcaagtgggtatctcg
gatatggatgtggccgtacgcaggagcgttgtggagtccttggacgctcgtttcgatgag
ctgttgagtcaggagacacatttgaaactggtcttcctcttgttgaacgacgagagcgcg
attatccgcgaacgtgccatgcaattattggaacggctagcacctcgtaaccctgcgttc
gtgatgccatcgttgcgtcgtgtgataattcaattggtcacagaactgcagcacacgttt
gatctacgcatgcgcgaggacagcacccgacttctgggccaccttattcgtggagctcag
cacttggtcgacccgtacgtcgtgcgtatcctcgaggtgcttctaccgattctcgtgcgc
ggcaatgctccgttgacgatggcagttttagtcactcttggggagctggcgctggtgtcg
cgtacgcagatcgctgcatacgaacgctatctcttcccgcttatcatccacacactccaa
gatcactcgtctattgagaagcgtcaagtggcgttgcagactttaggtcaactggcgggt
agtacaggctgcgtggtgcgtccgtatctagcgtctcccaagttgttggagatctttctc
agtctcttacatcacaacgtgggcagtccgtggtctctacgacgtgaggcgatgaggact
atcggcattctcggcgcgttggatccgtacaaatacaagctgtgtatttcaagggcatcg
ctaagacaagcgaacgaagtggcgtccacaaccgacacgtcaacgaccaaggaagagacg
gacaagaacgcggacacggcgccactcggcgtatcaaagtcactagcaggctccgtggcg
ccgcagtacccgacgctggaaatcgacttgaaggcgctgggcgtgaccatcaacctcgca
agtttcgaccgcaagacgacaagcgacgcgctggacgagaagcagcagattgagttgcaa
ctatttactgcagcacctatcggtaccaggaaaatcgacgccggtacagctgccggtacg
ttggggattggctcgcagtcttctcatcctgtgagtggcgcagcgggtgtgtctgctgga
gcttcgtcctcgtcgttgtcttcttctaagaagcgacagataggctcgattggcatgagt
ctgagtgacgactctttcgactttgagagctccctgatggacagcgagttggagctggac
cccaccgagttgtcgccagcgtccgaggcctatttccctacggttgctatccacgcgctg
ttgcgcattctacgcgagccgtcattgaacgcgcaccaccacggcgtcatccaggccatt
atgtttatcttcaagagtctcagcacgcagtgtgtgccgttcctcaaatacattttgccg
ccgttcctgcgagttctgtcccgtggtgagccgcgactacgcgagtcgctgttcctgcag
ctcacgactttgatttccattgtaaacgcccacatgaagccgttcttcccgccgatcatg
gtgctcgcgctgcggttctgggggtcgcatctcacgcagattgttcgtctcgtcgagaag
atctcccaggcggcgccgcacgagttccgcacccagtattttcccaagttattgccaaaa
ctactggaagttctccagccgcatttcggattgggcggcgctgcagacggcgagcttgct
ggagctagtgctggtgttagcggcgcaacagcaatcacacaaggctctggagacagtgtg
agtgtcgttggaggaagtggagaccacggacaggcaggcgacagcgtctcaggtggaagc
agcgaccacacgtcgagtacttacgacatcgtccagaacggcagtgcagatggcataacg
gccgtcgcggtggcagcgatccaggtgcaagtggtgcaggcgctgattgtgtttggcgac
gccgtggaggattacgtttatctggtggtgcctgccctcgtgcatctcatggaaagtctg
gacactccgcttgaagtgaagattaccaccgtctacgcactcgcgcgtatttgtgtggtc
gccaattttgaacagtatgctggaccgagactgctgcagcctcttgcacgcgtggcgtca
caagtgtcagccaagggcgcgttcttcttcagtcgctcgagcagcagtgctgccatccct
gtgagtggtggctcgagtatctctgggtcgtctggaagcggatcatcaggtgcagcagcg
gctcggattgccacgtccaaatcggaagctacacgcttctccgaggtgatgctgtatgcg
ctaggagctctggtatttcagctgcaagcagaagtcttgagcttcgagccgctgatgcag
cagatcatcgcatcgctgccattctcgcagcgtggcaatctcgcgacggctgttaatgat
gctgaaggaggcagtccctcgtcatcgccacaagcaatggtacagcggatcgctcaggcg
ctggagagtttacgttacggcgctcgagtcccacggacgttcctgagtgacccggcattc
atgacgtctacgttacgaaagttctcgacggagctgcaagcgcagaccgcgacgtcgatg
actccagcggcctccccaccaacgagtgctcgcttgcatgtcaaccagcagaatctgcgt
cgagcatgggaagcttcacagcgcagcacgaaggaagattggctcgagtggatgcggcgc
ttctcgatcgaattgctgcgtgaatcccccagtgctgcgctgcgttcttgttgcgcgcta
gctcaggcgtataatcctctggcgcgtgcattgtttaaccctgcgtttgtgtcttgctgg
aacgagctgtacgaacagtatcaggattatctggttcgagcgctggagactgcgttccag
agcgacacgatccctgcggagatattgcagacgctactgaatctcgcggagtttatggag
cacgacgtggaggcgttgccgatcgacatccgtgaactgggcgagttggcgcagaagtgc
catgcatatgccaaggcgctgcattacaaggagctagagttccatacgtcgcccagcacg
tgtatcgaggcgctgatctcgatcaacaaccagctaggtcagcccgaagcggccgtcggc
atcttgaagtatgcgcaagctcatcacagtcgcgtgatccaagtgaaggagacgtggttc
gagaagcttcaggactggcgcgcagctcttgcattgtacgaccgaagactgcagttcgct
cagcaacaaggaggagaggaccaggcgctagatatcgaggtttgtatcggaaagatgcgg
tgcttagaggcactgggcatgtgggaggaactgggggcgttggctacccaagtgtgggct
gcgttgcgctcgtccgagcgtagtccgagcaaagcaagcggcccgcctccgcgtagtcgc
ccgttgtctgctggccggactgcatccggtagcgctggcgctggctccggccggggtaat
cccggtcttctccgtcgaggcagtagcaactacggctcgtcttcgtccttggcctcggcg
gggggccctccgccgtcttcttcgtaccagcttggagatgaccgaggcgacgaagcgaaa
gcgcttcgacgagtggcgatgctcggagctcgagcgagctggtgtctgtctcaatgggac
agcatgacgcagtacgtgacggagtgtgcagcgcaaaacgacaaaagcaacgccaatagt
acagttatctctcgagctgctaacggaaatggacaaggctacggctacggccacacgcac
ggccacgggatcttcggcgcagatgaagacgtcacggagttgtcgttgtatgagtcagtg
ttggccgtacaccgcggcaactttgaccaggcaacgacgctcattgatgcgacacgaaag
acgctggatacgaaactcggagcgctggtgggcgagtcgtacagccgcgcataccgcagc
atggtgactttgcagcaactgagtgaactggaggaggtcgtgacgtacaagaagctgcgt
gctcagatctctaaaggcgaagaagctgcgcgatacaagcgccacttgatgcgcatgtgg
cgtgaccgtctgtcaggctgcaagcgcgtggtggaagtgtggcagcagttgattgctgtc
cgtgcgttgatcttgtcgccacacgaagacatcgacacgtatctgcagttcgctagcttg
tgtcggcagtcagggaacctctcgctgtcgctcaaggtgttcaccaatgctctccacgtt
catggcggctcaggatccaacggaacaggcatctcggagatgttaagtgtggctccgtca
agttcagcagccacttccttcggatttggcgagaaggaccgcaaccgcgtggccttcgcc
tacttgaagcacctctgggctgctggacagaagcaggaagcgctctcagacttgcatcgc
ttggtggtgcgtatctcgtccatggccaagcatcgttcccagcctccaggtggcatgggt
gggatgccatctcctgcaccagcgatgatgcctatgagaagcgaagaagaagagctgctt
gtcaagtgtcacttgaagatggcggagtggcagctggcagtacacgaccagcagatcgaa
cacgtgccagtggaaagtgtgctatcctctttacggttgtgtaccgaactggagccgcgt
agctacaaggcgtggcatgcgtgggctctgatgaatttccaggtggtcgagcactcgaca
cacagtcaacatatctcggcgaacgcgactgcatcggccgttgcaccgtctgcttcggtg
gctccgtacatcgctccggctattgaaggcttcttccgctccgtcgcgctgggtcgcagt
cgctgggctgccaacgtccaacaggatattctacgtgtcttgacgctgtggtttgcacac
ggccaccgtaccgacgtgcatgccgccttggagaaaggttttcggtccgtgagtatcgag
acgtggctcattgtgatcccgcagctgatcgctcgtatccacacgccatacccgcgtatc
caaaagcagctccatcgtctgctagtggcagtagggaagcagcatccacacgcgctcatc
tatccgctgtctgtagcgctcaagtcgtcggtgagtgaacgtcagcaagcggctgaagcc
atcatgagtacaatgcgcaccaactacgtggagctcgtggatgaggcgctgctggtgagt
cgagaactcatccgcgttgccattttgtggcacgaaatgtggcacgaaggcctggaagaa
gcttcgcggttgtatttcggcgagcacaatgtggacggcatggcggaagtgctgcgacct
ctgcacgcgatgatggagcgaggccccgagacgctacgtgaggtgagcttccacggggcg
ttcggccgtgacttgcgcgaagccaacgagtggttgcagcgattcctgagcaatcgccgc
aacgaatcggacctgaatcgcgcgtgggatctgtactaccacgtcttccgtcgtatcaac
aagcagctaccacagatcacgacgctggaactgcaagtggtgtcgcccaacttgctacag
gcgagaaacctgcaactggcggtccctggaacataccgtgctggtcacgctctcgtcaag
attggcagcttcttacctacagtggcggtgatcacgagtaagcagcgacctcgtcgcatc
acgatcgtgggctccaatggactggagtacatgttcttgctgaagggccacgaagattta
cgtcaggacgagcgtgtgacgcagctctttggcctagtgaacgcgttgctgatcaacgat
cgtaatacgtccaagaaagacctcaagatccatcggtacccggtcatcccgctgtctgac
aacgccggtatcgtcggctgggtgcctcattgtgatactcttcaccagctgatccgcgac
taccgtgaggcgcgtaagatcctgctgaacattgagcatcgcttgatgctccagatggcg
ccagactacgacgcgctaacgctgctggagaaggtggaagtgttcttgtatgcactggag
aacacagccggtcaggacttgtacaaggtgctgtggctcaagtcggagaactcggaggtt
tggctggaccgacgcacgaactacacgcgctctctggccgtcatgtcgatggtgggctac
attctcggactgggcgatcgtcacccgagtaacttgatgctgcatcgcttcaccgggacg
atcgtgcatatcgactttggtgactgctttgaggttgcgatggatcgagagaaatatccc
gagaagatcccgttccgactcacacgcatgctgacgaacgccatggaagtgagtggcatc
gaaggcaacttccgcttctcgtgcgagagtgtcatggcggtgttgcgtgagaaccgccac
agtctcatggctatgctcgaagctttcgtgcacgatccgttgatcaattggcgtctgctg
tcggctaccaacgtgcagtcttcgagtcacgcgggcagttcagtggcgtcgagtgtcgtg
tcatcttcgatggtttccagtgcgatgagtatggacagcgagagcgactatgagccgtca
gaagcttcgtcgcatggacagtcggagtactcgtcggataattcttcccatggaccgtat
gacgattcctcacacggaccatcggaagcttcgtctcatggcccttcagaggcctcgact
catggaggcgaagaggaagcaacacatcgtcgtagtgagagcatctcgatcccagatccc
acaccttcatcgactgctacgctattagacgatcgagatgagccgcggcctaatgccagc
aagacacaagatgctccagtacaagacgacaagcaagagacaagggaagagaccaaggtg
tatgaggtggattctactgaagctcaacaagctcaacaactcccgccgcggccagtgcca
cgtcaaatcagcgccagtttggctgctccacgtcagttgcctccgcgaccaaaggaagag
cctgcgccgcctccactgccgtcttccttgtcgtcacgtccgatgagtctcagcaagtcc
atcccgatgcgtaagctcccacctcgtgcgccagccaatcgtctacgcgaagacgcgatc
gatgagaacgaggagtcgaatgtcgtcgagaagatcgactactcgactacgaacttacat
gccgagatctcgtcgttggccgccagtgtatccagcgtcggccactcgagtttaagtcgc
agtttctccgtcactcaagctcagatccaggcgcagtctcagatacgacaacaacgacaa
caggctgataagggccagtcaactcaggcgcccagtacaccactgggccccccaccacga
atggctccggccgcgtcgacgtcgttcgtgtctgtcacggcagctgcacacatcccgccg
tcctcggatactgtgccgccatcagtggctaacaacgatttgcatgccaaccgcagtgtc
cgcgaacgtgagctgctgagcgctctgggacccgaaggcattgcagcgccacgtgttgcg
ttgaacgagaaggccgtcgccgtcattcgacgtgtccaggcgaaactgtccggccgggac
tttgaaggagacggtgagccactggatgtgagtgcgcaagtgcagcgtctcatctcgcaa
gccacctcgcatgaaaatctctgccagtgttacatcggctggtgtcccttctggtaa

DBGET integrated database retrieval system