KEGG   Phytophthora infestans: PITG_15486Help
Entry
PITG_15486        CDS       T01333                                 

Definition
general transcription factor IIH subunit, putative
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pif  Phytophthora infestans
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pif00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PITG_15486
  Replication and repair
   03420 Nucleotide excision repair
    PITG_15486
Transcription machinery [BR:pif03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PITG_15486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MDAFDFLETLPPATLERLYQDPWACQAIFQALPSLAQQFVMRLLPTNSAVPRDLLEQWVV
PIPGETKRMPPQFNAALQKLEGLRVFVQQDGGYKPHPTFQKQLMYALSNLGGSPWERGRL
HLPRDPENTFAAVDLERYARARWDLVLHYMVGSTAVQEPPQSVVDILLRTKLLQASGADS
RALHITDTGYEFMLKDIHVQMWIFMLEYIRTLDNTGTLKQEDILQFLFQISYCQTGGYYA
VADLTETQRLLLGDFIDFGLLFRKRQNSDRFYTTSLAVNLIFGGSTGQKRSHVSLTSSFA
GVRAGMKSQVADPRQAPTVDHGARLLVVVETNFKIYAYTSSTLHVAMLSVFVDIVARLPN
LAIGFITRESLRSALIHGISAQQIYDFLMKHAHPKMRRNSPVIPENIADQIYLWERERNR
VQFLEGILFDGFNTKEDYESVRDYAKGLMVLTWSDPIHFRLSIATAGIDEVRHFIQNQVS
TRG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggatgccttcgacttcctcgagacgctgccgccggcaacgctggagcgtctgtaccag
gatccatgggcgtgccaggctatcttccaggctctaccatctcttgctcagcagttcgtg
atgcgtcttctgcccacaaactctgccgtaccgcgtgatctactggagcaatgggttgtg
ccaataccaggagaaaccaaacgcatgccgcctcaattcaacgccgcgttgcagaagctg
gagggacttcgagtgtttgtacagcaagatggaggctacaaacctcacccgacgttccag
aagcagctcatgtatgcgctgagcaacttgggcggatctccgtgggaacgtgggcgacta
catcttcctagggacccggagaacactttcgctgcggtggatcttgagcggtacgcgagg
gcacgctgggacttggtgctgcactacatggtggggtctacagcagtacaggagccgcca
cagtccgtggtggacatcctactgcgtacaaaactactgcaggcaagtggggcggactcc
agggcgctgcatatcacagacacgggctacgagttcatgctgaaggacatccacgtgcag
atgtggatctttatgttggaatacattcgcacgctggataacacgggcaccctgaagcag
gaggatattctgcagttcttgttccagatcagctactgccagacgggagggtactacgca
gtagcagatctgacggagacccagcgactattactcggagatttcattgacttcggacta
ctgttccgaaaacgccaaaattcggatcgcttctacacaacaagtctggctgtgaacctc
attttcggtgggtccacgggacagaagcgtagccatgtcagtctcacgagctcgtttgct
ggtgttcgtgccggtatgaagtcgcaagtggcagatccgcgtcaggccccgacagtcgat
cacggagctcgtctgcttgtggtggtggagacaaacttcaagatctacgcgtacacttcg
tcgactcttcatgtggctatgctcagcgtgtttgtggacattgtggcacgactaccgaac
ttggccattggcttcatcactcgagagagtctgcgctctgctctgattcacggcatctcg
gcccagcagatctacgacttcttgatgaagcacgcgcacccgaaaatgcgacgcaacagt
ccagtgatccctgagaatattgctgaccagatctacttgtgggaacgcgagaggaatcgc
gtacagtttctggagggaattctattcgacggtttcaacaccaaggaagactacgagagt
gttcgggactacgccaagggtctcatggtgctcacatggtcggatcccattcacttcagg
ctgtcgattgctactgcaggtattgacgaagtacgccactttatccagaaccaagtatcg
actcgaggataa

DBGET integrated database retrieval system