KEGG   Phytophthora infestans: PITG_15705Help
Entry
PITG_15705        CDS       T01333                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase, putative
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pif  Phytophthora infestans
Pathway
pif00020  Citrate cycle (TCA cycle)
pif00310  Lysine degradation
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01200  Carbon metabolism
Module
pif_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pif_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PITG_15705
  Amino acid metabolism
   00310 Lysine degradation
    PITG_15705
Enzymes [BR:pif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PITG_15705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl GCV_H Glyco_hydro_79C
Motif
Other DBs
NCBI-GeneID: 9475453
NCBI-ProteinID: XP_002897983
UniProt: D0NSD5
AA seq 537 aa AA seqDB search
MHGSGRVLLRAAARANGAARRSLTSISSSAGVLAARSSSSSALKLRGASAVSVRAQRLNA
ASAVQFRGFSSSGDATDVPVPSMGDSISEGTVVEWLKQPGDAVAEDEVVVVLETDKVSVD
VRAPFAGAMGQQLAAIDDNVTVGSPLFQIVKGAAGAESAQETKPETKTEAAPAAAAPSGE
ETTVPVPSMGDSISEGTIVEWIKKSGDYVAEDEVVVVLETDKVSVDVRAPKAGTITKTLA
DVDQTVEIGVPLFSMVFGGEAPASSPVPEAPASTPTPAPASTPAPAATPEPAAGTNPLLA
TPERASRREKMSRMRLRTAERLKESQNTAASLTTFQEVDMSKLMGLRKQYKDAFEAKHGV
KLGFMSAFVKASASALLEVPGVNAMIDDEHQEIVYRDYVDMSVAVSTPKGLVTPVLKNTE
SMSFADVEKGLAELAARARDGKLTLEEMTGGNFTISNGGVFGSLMGTPIINLPQSGILGM
HGTKMRPVVVDGEVVARPMMYLALTYDHRLIDGREGVTCLKAIADKIENPERLLLDI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcacggctccggacgtgtcctgcttcgtgccgccgcgcgtgccaatggcgccgcgcgt
cgctccctcacatcaatcagtagcagcgctggcgttttggctgctcgctcatccagttcc
agcgcactgaagctgcgcggcgccagcgctgtgtctgtgcgtgcgcagcgtctgaacgcc
gcgtcagccgtgcagttccgcggtttctcgagctctggcgatgctacggacgtgcctgtt
ccgtctatgggtgactcaatctcggagggaaccgttgtggagtggctcaagcaaccagga
gacgctgtggccgaggacgaggtcgttgtcgtgctcgagacggacaaggtgagcgtggac
gtgcgcgcgccctttgccggcgccatgggccagcagctggccgccatcgatgacaacgta
acggtaggctcgccattgttccagatcgtcaagggcgctgcgggcgccgagagcgcgcag
gagaccaagccggagaccaagacggaagccgcgccggctgccgcagctccgtccggcgag
gagactaccgtgcctgtgccgtccatgggtgactccatctcggaaggaaccatcgtggag
tggatcaagaagtccggagactatgtggctgaggacgaagtcgtcgtcgtgctcgagaca
gacaaggtgagcgtggacgtccgtgctcccaaggccggcaccatcaccaagacgctggct
gatgtagaccagacggtggagatcggcgtgccgctcttctctatggtgttcggtggtgag
gcgcccgcctcttcgcccgtgccggaagctccggcttctactcccacgccggcaccggca
tcgacgccggcacctgccgccacgcccgaaccggctgccggcactaacccgctactagcc
acgcctgagcgcgcgtctcgtcgcgagaagatgagccgcatgcgtctgcgcacagccgag
cgcctgaaagagtcgcaaaacacggcggccagcctcacgacgttccaggaggtcgacatg
tctaagcttatgggtctacgtaagcaatacaaggacgcgttcgaggccaaacacggcgtt
aagctgggtttcatgtctgctttcgttaaagccagtgcgtcggcactacttgaggtgccc
ggcgtcaacgctatgatcgacgacgagcaccaggagatcgtttaccgtgactacgttgac
atgagtgttgctgtgtcgacccctaagggtctagtgacgcctgtgttgaagaacaccgag
tctatgagcttcgctgatgtggaaaagggtctggccgagctcgcggctcgcgcgcgtgac
ggcaaactgacgctcgaggagatgaccggcggcaactttaccatctcgaacggcggcgtc
ttcggctcgcttatgggcacgccgatcattaacctgccgcagtccggcatcctcggcatg
cacggcaccaaaatgcgaccggtcgtggtggacggagaggtcgtcgcgcggcccatgatg
tacctggcgctcacgtacgaccaccgcctcattgacggccgtgagggcgtcacgtgcctt
aaggccattgccgacaagatcgagaacccggagcgtctgttgctcgacatttaa

DBGET integrated database retrieval system