KEGG   Phytophthora infestans: PITG_15705Help
Entry
PITG_15705        CDS       T01333                                 

Definition
dihydrolipoamide succinyltransferase, putative
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pif  Phytophthora infestans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PITG_15705
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PITG_15705
  Amino acid metabolism
   00310 Lysine degradation
    PITG_15705
Enzymes [BR:pif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PITG_15705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 537 aa AA seqDB search
MHGSGRVLLRAAARANGAARRSLTSISSSAGVLAARSSSSSALKLRGASAVSVRAQRLNA
ASAVQFRGFSSSGDATDVPVPSMGDSISEGTVVEWLKQPGDAVAEDEVVVVLETDKVSVD
VRAPFAGAMGQQLAAIDDNVTVGSPLFQIVKGAAGAESAQETKPETKTEAAPAAAAPSGE
ETTVPVPSMGDSISEGTIVEWIKKSGDYVAEDEVVVVLETDKVSVDVRAPKAGTITKTLA
DVDQTVEIGVPLFSMVFGGEAPASSPVPEAPASTPTPAPASTPAPAATPEPAAGTNPLLA
TPERASRREKMSRMRLRTAERLKESQNTAASLTTFQEVDMSKLMGLRKQYKDAFEAKHGV
KLGFMSAFVKASASALLEVPGVNAMIDDEHQEIVYRDYVDMSVAVSTPKGLVTPVLKNTE
SMSFADVEKGLAELAARARDGKLTLEEMTGGNFTISNGGVFGSLMGTPIINLPQSGILGM
HGTKMRPVVVDGEVVARPMMYLALTYDHRLIDGREGVTCLKAIADKIENPERLLLDI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcacggctccggacgtgtcctgcttcgtgccgccgcgcgtgccaatggcgccgcgcgt
cgctccctcacatcaatcagtagcagcgctggcgttttggctgctcgctcatccagttcc
agcgcactgaagctgcgcggcgccagcgctgtgtctgtgcgtgcgcagcgtctgaacgcc
gcgtcagccgtgcagttccgcggtttctcgagctctggcgatgctacggacgtgcctgtt
ccgtctatgggtgactcaatctcggagggaaccgttgtggagtggctcaagcaaccagga
gacgctgtggccgaggacgaggtcgttgtcgtgctcgagacggacaaggtgagcgtggac
gtgcgcgcgccctttgccggcgccatgggccagcagctggccgccatcgatgacaacgta
acggtaggctcgccattgttccagatcgtcaagggcgctgcgggcgccgagagcgcgcag
gagaccaagccggagaccaagacggaagccgcgccggctgccgcagctccgtccggcgag
gagactaccgtgcctgtgccgtccatgggtgactccatctcggaaggaaccatcgtggag
tggatcaagaagtccggagactatgtggctgaggacgaagtcgtcgtcgtgctcgagaca
gacaaggtgagcgtggacgtccgtgctcccaaggccggcaccatcaccaagacgctggct
gatgtagaccagacggtggagatcggcgtgccgctcttctctatggtgttcggtggtgag
gcgcccgcctcttcgcccgtgccggaagctccggcttctactcccacgccggcaccggca
tcgacgccggcacctgccgccacgcccgaaccggctgccggcactaacccgctactagcc
acgcctgagcgcgcgtctcgtcgcgagaagatgagccgcatgcgtctgcgcacagccgag
cgcctgaaagagtcgcaaaacacggcggccagcctcacgacgttccaggaggtcgacatg
tctaagcttatgggtctacgtaagcaatacaaggacgcgttcgaggccaaacacggcgtt
aagctgggtttcatgtctgctttcgttaaagccagtgcgtcggcactacttgaggtgccc
ggcgtcaacgctatgatcgacgacgagcaccaggagatcgtttaccgtgactacgttgac
atgagtgttgctgtgtcgacccctaagggtctagtgacgcctgtgttgaagaacaccgag
tctatgagcttcgctgatgtggaaaagggtctggccgagctcgcggctcgcgcgcgtgac
ggcaaactgacgctcgaggagatgaccggcggcaactttaccatctcgaacggcggcgtc
ttcggctcgcttatgggcacgccgatcattaacctgccgcagtccggcatcctcggcatg
cacggcaccaaaatgcgaccggtcgtggtggacggagaggtcgtcgcgcggcccatgatg
tacctggcgctcacgtacgaccaccgcctcattgacggccgtgagggcgtcacgtgcctt
aaggccattgccgacaagatcgagaacccggagcgtctgttgctcgacatttaa

DBGET integrated database retrieval system