KEGG   Phytophthora infestans: PITG_16048Help
Entry
PITG_16048        CDS       T01333                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pif  Phytophthora infestans
Pathway
pif00010  Glycolysis / Gluconeogenesis
pif00051  Fructose and mannose metabolism
pif00562  Inositol phosphate metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01200  Carbon metabolism
pif01230  Biosynthesis of amino acids
Module
pif_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pif_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_16048
   00051 Fructose and mannose metabolism
    PITG_16048
   00562 Inositol phosphate metabolism
    PITG_16048
Enzymes [BR:pif01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PITG_16048
Exosome [BR:pif04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PITG_16048
  Exosomal proteins of bladder cancer cells
   PITG_16048
  Exosomal proteins of melanoma cells
   PITG_16048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 9473837
NCBI-ProteinID: XP_002897824
UniProt: D0NSR2
AA seq 280 aa AA seqDB search
MSFRQVFKTQARHMSSSSRKFFVGGNWKCNGSLGQAQELVGMLNTAKIPVNVEVVVAPSQ
VHAATVKASLRSDVRVSGQDVWKQGNGAFTGETSAEMLKDLGAEYTLVGHSERREKGETN
EVVAKKAAYALEKGLGVIACIGETKDHREANQTVAYITEQLDAYAAGINDWTNVVIAYEP
IWAIGTGLTASPEQAQEVHASIRAWLKEKVSPEAAEQTRVIYGGSVGAKNAPELSQKEDI
DGFLVGGASLKPDFLQIINAQNPTANVGGAVNVAINGFGR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccgtcaagtgtttaagacgcaggcgcgccacatgagctcaagctcgcgcaag
tttttcgtgggcggtaactggaagtgcaacggctccctgggccaggcgcaagagctcgtg
ggaatgcttaacacggccaagattccagtcaatgtggaggtcgttgtggccccttcgcag
gtgcacgccgctaccgtcaaggcttcgctgcgctccgacgtgcgtgtcagcggccaggac
gtctggaagcaaggcaacggcgccttcacgggcgagacctcggccgaaatgctcaaggat
ctgggcgctgagtacactcttgtaggccacagcgagcgccgcgagaagggcgagaccaac
gaggtcgtagccaagaaggctgcctacgctctcgaaaagggcctgggcgttattgcttgc
atcggtgagaccaaggaccaccgcgaagccaaccagaccgtggcctacatcacggagcag
ctcgacgcctacgccgccgggattaatgactggaccaacgtcgtcattgcctacgaaccc
atctgggccatcggtacgggtcttacggcctcgcctgaacaggctcaggaggtgcacgcc
agcattcgtgcctggctcaaggagaaggtgtctcctgaggctgcagagcagacccgcgtc
atttacggtggatcggtcggcgcgaagaacgccccagagctctcgcagaaggaagacatt
gacggcttcctggttggtggtgcttcgctcaagcccgacttcctccagattatcaacgct
cagaacccgacggccaacgtcggtggcgctgtgaacgttgctatcaacggcttcggtcgt

DBGET integrated database retrieval system