KEGG   Phytophthora infestans: PITG_16865Help
Entry
PITG_16865        CDS       T01333                                 

Definition
aldose 1-epimerase, putative
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pif  Phytophthora infestans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_16865
   00052 Galactose metabolism
    PITG_16865
Enzymes [BR:pif01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PITG_16865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MSVKFLNQGATINEIVVGGRNIVLGFPTPELYVEHCGPHFGETVGRVANRVSGAKVELND
KSYDLIANDGVNSLHGGNTWGLKPFEGPTAVKNHEGKDAMQYKLVSPDGDSGFPGTVELT
VTYTQRTSRTENDKELVELEIEYEAELVGPEDVKETAINITNHSYFNLSGRETIDGTEVT
LASDQYLVPDEGNIPTGEVETFPGIKANQAFTLGVKEPNVDHCFLMNQDSKSIPLDTRKL
PLQLLVTADHPDTRIHLQVLSTEPAFQFYTGFWNDVPAVAGQPARGSRSGFAVEPGRFVN
AINTPKWRNQMLLPKGEKFGSRIVYRAWAA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaagttcctgaaccaaggagccacgatcaacgagatcgtcgtcggtggccgc
aacatcgtgctgggcttccccacccccgagctctacgtcgagcactgcggtccccacttc
ggagagaccgtgggtcgtgtcgccaaccgcgtctcaggcgccaaagtggagctcaacgac
aagtcgtacgacctgattgccaacgacggcgtcaactcgctccatggtggcaacacgtgg
ggactcaaacctttcgagggccccacagctgtcaagaatcacgagggcaaagacgcaatg
cagtacaaactcgtgagtcccgacggagactcgggattccccggaactgtcgagctcaca
gtcacatacacacaaaggaccagtaggaccgagaacgacaaggaactcgtggaactcgag
atcgaatacgaagcggaacttgtcggtcccgaagacgtcaaggagacggccattaacatc
acaaaccacagctactttaacctctcgggtcgtgaaactatcgacggtaccgaggtgacg
ctggcctcggaccaatatttggtgccagacgagggaaatattcccactggggaggtcgag
accttcccgggaattaaagccaatcaggcgttcacactcggggtcaaggagcccaatgtg
gaccactgtttcctcatgaaccaggactccaagagcatcccgctcgacacgcgaaagctg
ccgctccagttgcttgttacagccgaccacccggacactaggatccaccttcaagtgcta
agcacagagcccgctttccagttctacacgggcttctggaacgacgtgccggccgttgcg
ggacagcccgcacgtggctcccgttcgggcttcgccgtcgagcctggtcgcttcgtgaac
gctatcaacacgcccaaatggcgcaaccagatgctgctacccaagggcgagaagttcggc
agtcgcatcgtttaccgcgcttgggcagcgtag

DBGET integrated database retrieval system