KEGG   Phytophthora infestans: PITG_16977Help
Entry
PITG_16977        CDS       T01333                                 

Definition
aurora-like protein kinase
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
pif  Phytophthora infestans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 383 aa AA seqDB search
MRRFDADKENRVATTSSYSQRAPLSSRQLKPAGTATASGAMKRPHNQTDGSKYPRKAGGD
RTDASRRPHGDAPSYLHGTGLYKATTGSSVPNRLGSTSSKASAVSANAETKTDETSSGKK
TWKLSDFEIGKPLGKGKFGNVYLAREKQSKYVVALKVLNKQQLMKSSMEHQLRREIEIQS
HLRHKSILRLYGYFYDAKRVYLIIEYAPQGELYKKLMRAGRFSEKQSALYIQEMARALIY
MHSKHVIHRDIKPENLLVGFHGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIENKPH
DENVDVWTLGILMYEFLTGAPPFETENTKETYRRIAHVDLKFPSYVSSEARDLLVKILRH
DPQHRISLERVLEHPWIVQHCES
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcgacggtttgacgcggacaaggagaaccgcgtggcgaccacctccagctactcgcag
cgcgcgccgctctcgtctcgccagcttaaacccgcaggaacggctaccgcgtctggcgcc
atgaagcggccccacaaccagacggacggctctaaatacccgcgcaaagctggaggagac
agaaccgacgcctctcgacggccacacggcgatgcaccgtcgtatcttcatggcacaggt
ttgtacaaggcgactacaggctcttcagtgcccaatcggttaggctccacgagttccaag
gcctcagcagtctctgccaacgcagagacaaagaccgacgagacgtcgtctggaaagaag
acgtggaaactcagtgactttgagatcggcaaaccgttgggcaagggaaaattcggcaac
gtttatcttgctagagagaaacagtccaagtatgtggtggcactcaaggtgctgaacaaa
cagcagctcatgaagtcgagtatggagcatcagttgcgtcgagagatcgagattcagtcc
cacctgcgacacaaatccatactgagactgtacggctacttctacgacgccaagcgcgtg
tatctgatcatcgagtatgccccgcagggagagctctacaagaagctgatgcgtgccggt
cgcttctcggaaaaacagtcggctctgtacattcaggagatggcacgtgctcttatctac
atgcacagcaagcacgtgatccatcgagacatcaagcccgaaaacctgctcgttggcttc
cacggagagctcaagattgctgacttcgggtggtcagtacacgcgccgtcttctagacgc
acgacgctctgcggtacactggactacctgccacctgagatgatcgagaacaagccacac
gacgaaaatgtggacgtatggacgcttggcatcctcatgtacgagtttctaaccggtgcg
cctcctttcgagaccgagaacaccaaggagacttatcgccgcattgcgcacgtggacctc
aagtttcctagctacgtgtcttccgaggctcgagatctgctggtgaagattctgcgtcac
gacccacagcaccgcatctcactggaacgcgtgctggaacacccatggatcgtgcagcac
tgcgagtcgtag

DBGET integrated database retrieval system