KEGG   Phytophthora infestans: PITG_17003Help
Entry
PITG_17003        CDS       T01333                                 

Definition
choline/ethanolamine kinase, putative
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
pif  Phytophthora infestans
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PITG_17003
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PITG_17003
    2.7.1.82  ethanolamine kinase
     PITG_17003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MAFTNDSATEAAVVVAPYLAAVAIVDKAKLKLQASIVSTLTKCIPSWNDVVPDSVDVEHL
GGAMTNLIFSVHKPEGKDRDVLVRVYGEGTESFFSRVEETRLFQLLSDKKIGVELLGQFA
NGRAEKLIHGSTYTSKRMRLPDESRIIARQLRVFHELDIDIDRKPTYISSVRKLLEVARV
KCTADTFKDILDLKQVASDVDEMEKILAEVPSPIVLSHNDMQYGNIMKKDTGDAVLIDFE
YTSYNPRGYDLGNHFCEWAYDYHKTVNPHLGDFSKYPTQEQQRNFCRAYLAGKDGDEKDV
SENEIESLRREANTYSLACHLFWALWGYIQASQSTIDFDFLAYGKCRYDAFKSRVTLKN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaccaacgacagtgcaacagaagctgccgtggttgtcgccccctatctggcg
gccgtggccatcgttgacaaggccaagctcaagctacaggcgtccatcgtctctacgctg
accaagtgcatcccctcctggaacgacgtggtgcccgactccgtcgacgtagagcatctg
ggcggcgccatgaccaacctcatcttctcagtgcacaagcccgaggggaaagaccgcgac
gttctcgtgcgcgtgtacggagagggcaccgagtctttcttctcgcgtgtggaggagacg
cggctgtttcagctgttgagcgacaagaaaatcggcgtggagctactaggccagttcgcc
aacggcagagccgagaagctcatccacggctctacgtacacgagcaagcgcatgcgtctg
cccgacgagtctcgcatcatcgccagacagctgcgtgtgttccacgagttggacatcgac
atcgaccgcaaacccacatacatctcgagtgtccgcaagttgctggaggtggcacgcgtc
aagtgcacagccgacacgttcaaggacattttggacctcaagcaggtggccagcgacgtg
gatgagatggagaagattctggccgaggtcccatctcccattgtcctgagtcacaacgac
atgcagtacggcaacatcatgaagaaggacactggtgacgcagtgctcatcgattttgag
tacacgagttataacccccgggggtatgacttgggtaaccacttctgcgagtgggcgtac
gattaccacaagacggtcaacccgcacctgggagacttctccaagtacccgacgcaggag
cagcagcgcaacttctgtcgtgcctatttggccggtaaggacggagatgagaaggacgtg
agcgagaacgagatcgaaagtctgcgacgagaggccaacacatactcgctggcctgtcac
ttgttctgggctctctggggctatatccaggcgtcgcagtcgacaatcgactttgacttt
ttggcatacggcaaatgccgctacgacgcattcaagtctcgcgtgacgctcaagaactga

DBGET integrated database retrieval system