KEGG   Phytophthora infestans: PITG_17054Help
Entry
PITG_17054        CDS       T01333                                 

Definition
endo-1,4-beta-xylanase, putative
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     PITG_17054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MNAFIALVLGASVLASAFGDPRVMIESTYTDTKGLNDLAKSAWQNRGGKYMGTATGIKQL
SDPYYIQKLNGTSDFGMITPVNAMKWDATEPKQGVFTFEDADNIVAFANSTGARVRCHAL
VWHKQVPEWVQVLQKAELLEAMSNHITKVMTHFGNSCTAWDVVNEAIAEDGSYRESFWYK
KTGKEYISTAFKTANEVKANLSLEARLYYNDFNINVVNNKSDAVFEMATDLRSHKIWVEG
IGFQSHYSNNDSVAGAKIFDNFRRFTVKHMDVAVTELDVKTSMANPTVSEQQQQVGIITN
VVSACKKTVRCVGVTVWDFVDTYSWIKSSAPLLFYQPEGPSTPLVRKATYDAVTAGWIL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcttttatcgcgttggtgctcggtgctagcgtactggccagcgcgttcggcgat
cctcgagtcatgatcgaatcaacgtacacagacactaaggggttgaacgacctagccaag
tcagcatggcagaacaggggaggaaaatacatgggcaccgcgacaggcatcaagcaactg
agcgacccatactacatccagaaactcaacggcaccagtgacttcggaatgatcaccccg
gtcaatgctatgaagtgggatgccacagagcccaagcaaggggtctttacgtttgaggac
gctgacaacattgtcgctttcgccaacagcacaggagctcgagttcgctgccacgcatta
gtttggcacaagcaagttccagagtgggtacaagttcttcaaaaagctgagctgctggaa
gcgatgtccaaccacatcaccaaggtcatgacacacttcggaaattcttgcactgcctgg
gacgtcgttaacgaagctattgctgaagacggctcatatcgcgagtcattctggtacaaa
aagactggcaaagagtacatctcgaccgccttcaaaactgccaacgaagtcaaggccaac
ctcagcctagaggccaggctatactacaatgatttcaacatcaacgttgtcaataacaaa
tcggacgccgtctttgaaatggcaacggacctcagaagccacaagatttgggttgaaggg
atcgggttccagtctcactatagcaacaatgatagcgtggctggtgcgaagatattcgac
aacttcaggcggttcacagtgaagcatatggacgtcgctgtcacggagctcgatgtgaag
acgagcatggcgaaccccaccgtaagcgaacagcagcagcaagttggcatcatcaccaac
gttgtgtcggcctgcaagaaaaccgttagatgcgtcggcgtgacggtctgggacttcgtg
gatacttattcgtggataaaatcatcagctccgctgctattctaccagcctgaagggcca
agtacgccgctcgttcggaaggcgacgtacgatgctgtcacggctggctggattttgtag

DBGET integrated database retrieval system