KEGG   Phytophthora infestans: PITG_17333Help
Entry
PITG_17333        CDS       T01333                                 

Definition
serine/threonine protein kinase
Organism
pif  Phytophthora infestans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 577 aa AA seqDB search
MDRRRRVDNGNGRRRRSRSRSFSPVSSRLRYQLRRRHPRPPPVPSTPRRRRRRTAKDANE
NGTRSRSRSRSHHGSRSSRRRTDSRAPRSRSRSRSKRRHSGTRSRTGSSGSHRHRRRYSG
RKRSSRTDSQTRGRRGSSENDYNGRCRSSHGKNKQHHSRRRDSYHDREPLLPPPPAQKDG
SEDSVGHDDTVGSYAGKPGDYIANRYKIIREAGLGTFGRVLECLDKQRNIVVAIKVVRQV
EKYTESAKIEAAILQDVNDKDKKNESLCVRMFKWFEYKGHVCMVFERLGCSLYDYLKNHD
YKPFPLHCIRAYAWQLLTSLEFIHSIRLIHTDLKPENILLVDDEEERLSCESSSPSSTSS
YSSPDGSRREQWSNGRQWKKRAMSDADTGRLSLRPPANNAVKLIDFGGATYEDESKSSII
NTRQYRSPEVILGLGWSYPSDIWSAGCIIAELYLGELLFATHENMEHLALIERCLNPLPV
KMAARASKNSTSGQFFHRGRLNWPAAAPSEESVDHVRRMRKLEDLISPEDAQSGLLELLQ
LMLVLDPEKRVTAREALNSPFFDGFSYRNIVRAGHSD
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggaccggcggcgacgcgtagacaatgggaatggacggcgtcgacgtagtcgcagtcgc
agcttcagtcccgtgtcttcgcgactgcgctaccaactgcgaagacgccatcctcggcct
cccccggtgcccagcaccccgcgccggcgccgacgccgcactgccaaggacgctaacgag
aacggaacacgcagtcggagtcgcagtcgctcgcatcacggcagtcgctcctcgagacga
agaacagactcgagagcaccgcgatccaggtctcgatccaggtccaagaggagacactcg
gggactcgatcgcgcacgggatccagcggtagtcatcgccaccgccgacgatacagcggc
cggaaacggtcgtcgcgcaccgacagccagacacgcggacgacgtggcagctctgagaac
gactacaatggccgctgtcggtcgtcacacggcaagaacaagcagcatcactcacgacga
cgcgattcgtaccacgaccgagagcctttgctacctccaccgccagcacagaaggacggc
agtgaagacagcgtgggtcatgacgacacagtgggcagctacgccggaaaacctggcgac
tacattgccaaccgctacaagatcatccgcgaggccggtctgggcacgtttggacgtgtc
ctggagtgtctggacaagcagcgcaacatcgtggtggctattaaagtggttcgtcaagtg
gagaagtacacggagtccgctaagatcgaagctgcgatcctgcaggacgtgaacgacaag
gacaagaagaacgagtcgctctgtgtgcgcatgttcaagtggtttgagtacaagggccac
gtgtgtatggtgttcgagcgtctcggctgctccctgtacgactatctgaagaaccacgac
tacaagcccttcccgctgcactgtatccgtgcgtatgcgtggcaactgctgacgtcgctg
gagtttatccacagtatccgcctcatccacacagatctcaagcccgagaatattctgctg
gtggacgacgaagaggagcgactatcgtgtgagtcctcgtcgccttcctcgacgtcctcg
tatagctcacccgatggctccagacgcgagcagtggtccaatgggcgacagtggaagaaa
cgcgccatgtcagacgcagataccggtcggctgtcgctgcgtccaccagcaaacaacgcg
gtcaagctcattgatttcggtggcgccacgtacgaagacgagtccaagagctccattatc
aatacccgtcaataccgatcacccgaggtgattctcggactcggctggagttatccgtcg
gacatttggtctgccgggtgtattatcgccgaattgtacctaggcgaactgctgtttgcg
acgcacgagaacatggagcatctcgcgctgattgagcggtgcttgaaccctctgccggtc
aagatggcggctcgggcgtccaagaactcgacgtcaggccagtttttccaccgcggacgc
ctgaactggccggctgctgctccgagcgaggagagtgtggaccacgtgcggaggatgcgc
aagctggaagacttgatatcccccgaagacgcgcagagcgggctgcttgagttgctgcag
ctgatgttggtgctggacccggagaagcgggtgacggccagagaggcgctcaactcgccg
ttctttgatgggttttcgtatcgcaacatcgtgcgagcggggcacagcgactga

DBGET integrated database retrieval system