KEGG   Phytophthora infestans: PITG_17333Help
Entry
PITG_17333        CDS       T01333                                 

Definition
serine/threonine protein kinase
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PITG_17333
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   PITG_17333
Spliceosome [BR:pif03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PITG_17333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 577 aa AA seqDB search
MDRRRRVDNGNGRRRRSRSRSFSPVSSRLRYQLRRRHPRPPPVPSTPRRRRRRTAKDANE
NGTRSRSRSRSHHGSRSSRRRTDSRAPRSRSRSRSKRRHSGTRSRTGSSGSHRHRRRYSG
RKRSSRTDSQTRGRRGSSENDYNGRCRSSHGKNKQHHSRRRDSYHDREPLLPPPPAQKDG
SEDSVGHDDTVGSYAGKPGDYIANRYKIIREAGLGTFGRVLECLDKQRNIVVAIKVVRQV
EKYTESAKIEAAILQDVNDKDKKNESLCVRMFKWFEYKGHVCMVFERLGCSLYDYLKNHD
YKPFPLHCIRAYAWQLLTSLEFIHSIRLIHTDLKPENILLVDDEEERLSCESSSPSSTSS
YSSPDGSRREQWSNGRQWKKRAMSDADTGRLSLRPPANNAVKLIDFGGATYEDESKSSII
NTRQYRSPEVILGLGWSYPSDIWSAGCIIAELYLGELLFATHENMEHLALIERCLNPLPV
KMAARASKNSTSGQFFHRGRLNWPAAAPSEESVDHVRRMRKLEDLISPEDAQSGLLELLQ
LMLVLDPEKRVTAREALNSPFFDGFSYRNIVRAGHSD
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggaccggcggcgacgcgtagacaatgggaatggacggcgtcgacgtagtcgcagtcgc
agcttcagtcccgtgtcttcgcgactgcgctaccaactgcgaagacgccatcctcggcct
cccccggtgcccagcaccccgcgccggcgccgacgccgcactgccaaggacgctaacgag
aacggaacacgcagtcggagtcgcagtcgctcgcatcacggcagtcgctcctcgagacga
agaacagactcgagagcaccgcgatccaggtctcgatccaggtccaagaggagacactcg
gggactcgatcgcgcacgggatccagcggtagtcatcgccaccgccgacgatacagcggc
cggaaacggtcgtcgcgcaccgacagccagacacgcggacgacgtggcagctctgagaac
gactacaatggccgctgtcggtcgtcacacggcaagaacaagcagcatcactcacgacga
cgcgattcgtaccacgaccgagagcctttgctacctccaccgccagcacagaaggacggc
agtgaagacagcgtgggtcatgacgacacagtgggcagctacgccggaaaacctggcgac
tacattgccaaccgctacaagatcatccgcgaggccggtctgggcacgtttggacgtgtc
ctggagtgtctggacaagcagcgcaacatcgtggtggctattaaagtggttcgtcaagtg
gagaagtacacggagtccgctaagatcgaagctgcgatcctgcaggacgtgaacgacaag
gacaagaagaacgagtcgctctgtgtgcgcatgttcaagtggtttgagtacaagggccac
gtgtgtatggtgttcgagcgtctcggctgctccctgtacgactatctgaagaaccacgac
tacaagcccttcccgctgcactgtatccgtgcgtatgcgtggcaactgctgacgtcgctg
gagtttatccacagtatccgcctcatccacacagatctcaagcccgagaatattctgctg
gtggacgacgaagaggagcgactatcgtgtgagtcctcgtcgccttcctcgacgtcctcg
tatagctcacccgatggctccagacgcgagcagtggtccaatgggcgacagtggaagaaa
cgcgccatgtcagacgcagataccggtcggctgtcgctgcgtccaccagcaaacaacgcg
gtcaagctcattgatttcggtggcgccacgtacgaagacgagtccaagagctccattatc
aatacccgtcaataccgatcacccgaggtgattctcggactcggctggagttatccgtcg
gacatttggtctgccgggtgtattatcgccgaattgtacctaggcgaactgctgtttgcg
acgcacgagaacatggagcatctcgcgctgattgagcggtgcttgaaccctctgccggtc
aagatggcggctcgggcgtccaagaactcgacgtcaggccagtttttccaccgcggacgc
ctgaactggccggctgctgctccgagcgaggagagtgtggaccacgtgcggaggatgcgc
aagctggaagacttgatatcccccgaagacgcgcagagcgggctgcttgagttgctgcag
ctgatgttggtgctggacccggagaagcgggtgacggccagagaggcgctcaactcgccg
ttctttgatgggttttcgtatcgcaacatcgtgcgagcggggcacagcgactga

DBGET integrated database retrieval system