KEGG   Phytophthora infestans: PITG_17500Help
Entry
PITG_17500        CDS       T01333                                 

Definition
(RefSeq) glucosylceramidase, putative
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pif  Phytophthora infestans
Pathway
pif00511  Other glycan degradation
pif00600  Sphingolipid metabolism
pif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PITG_17500
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PITG_17500
Enzymes [BR:pif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PITG_17500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 9471268
NCBI-ProteinID: XP_002896564
UniProt: D0NWF4
AA seq 547 aa AA seqDB search
MRAVGCIAVGAAVIGSLSFAPHPALAACSSWSSLYQDHLEGVCVCNETQCDSVSNDYRSL
RKGHVGVFTTSQSGARLEYKEKKFHARPVSSPTFAIDVSTQYQTIIGFGAAFTDSAAINV
YKLSPKLQQILLDQYFSEKGLEYILGRVSIGSNDFSTSIYSYNDVEGDLAMENFSIDVDK
APKSHKIELIQRVLDMTSRDIKLFASSWAPPAWMTKENSTINCHLKGEPGDENWKALALY
YSKFFTAYKEEGIDFWAMTVQNEPEKPLLAFAKWQTLRISPEEERDFIKFDLGPLMKKHH
PNLKIIANDDQKPSILIRLEPLEDPDSLQCISGVAVHWYRNVDFVLGMGGHFGKLRKLHD
SYPDLFILPSEACEGYMPNPLGTGKGPFLTDADKSWTRGENYGRDIIGDLNSYAGGWTDW
NMVLDTKGGPNWAKNMVDAPILVDAKNGAEFYKQPMFYFMGHFAKFVPAGSRRIKISLNA
DSEIDSAFVTPDNQVVIQFLNLESSDEVANVQTTESSTFTVQVPSHSIVTAILPPSKETT
ILKSSSN
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgcgagctgttgggtgcattgccgtcggcgctgcggtgattggaagtctgtccttcgcg
ccgcacccggcattggcagcatgctccagttggtcttctctataccaggatcacctggag
ggcgtttgcgtctgcaacgaaactcagtgcgactcagtttcgaatgactatcgtagcctt
cggaagggacacgtcggtgttttcactacgtctcaatctggggcacgactcgagtacaag
gagaagaaatttcatgcgagaccggtgagcagtccgacgttcgctatcgacgtatcgacg
cagtaccagacgatcattggcttcggcgctgcgttcacggattcagcagctatcaacgtt
tacaaactgtcgccgaaactccagcaaatacttttggaccagtatttttcggaaaaagga
ctcgagtatatcctcggacgtgtatcgatcgggtcgaacgatttctccaccagtatatat
tcgtataatgatgtggagggtgatctcgctatggaaaatttctccattgacgtagataaa
gctccgaagtcccacaaaattgagctaatccagcgtgtgctggacatgacgtcgcgtgac
attaagctcttcgcttcatcgtgggcacctcctgcgtggatgacgaaagagaactccact
atcaactgtcatcttaaaggtgagcctggcgatgaaaactggaaggcactggcgttgtac
tactccaagtttttcacagcttacaaggaagaaggcattgacttctgggcgatgactgtc
cagaatgaacctgagaaaccccttctcgcgtttgctaaatggcagacgttgcgaatctcc
cctgaagaagaaagagactttattaaattcgatcttgggcctctgatgaagaagcatcac
cccaatttgaagattattgcaaatgatgatcaaaagccgagcattttgattcgcttggag
ccgcttgaggatcccgattcactacagtgtattagtggcgtcgctgttcactggtaccgc
aatgtggatttcgtacttggaatgggtggacactttggtaaacttcgaaagttgcatgat
tcctacccagatctattcatccttccgtccgaagcgtgcgaagggtacatgccaaacccc
ttaggaacgggtaaaggaccctttcttacagacgccgataagagctggactcgtggtgag
aactatggtcgtgacatcattggagacctgaatagctatgcgggcgggtggactgattgg
aatatggtcctggataccaaaggcggaccaaactgggcgaagaatatggtggacgcgccc
attctcgttgacgccaagaacggcgctgagttctacaagcagcccatgttctatttcatg
gggcatttcgccaaatttgtgccggcaggctcacgccgcataaaaatatccttaaacgca
gactcggaaattgacagcgcgttcgtcactcccgataatcaggttgttatccaatttttg
aatcttgaaagctcggacgaagtggcaaatgtacaaacgaccgaatcgagcaccttcaca
gtccaagtgccatcgcactccatcgtaacagcaattttgccaccttcaaaagaaaccaca
attctcaagtcatcttcaaattag

DBGET integrated database retrieval system