KEGG   Phytophthora infestans: PITG_17501Help
Entry
PITG_17501        CDS       T01333                                 

Definition
glucosylceramidase, putative
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pif  Phytophthora infestans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pif00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pif00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 539 aa AA seqDB search
MKALSPVAIFASSLLLAPSAVSAACSSWSSLYQDVLEGVCVCNATQCDTIVGDHTNLEEG
EIGIYTTAKAGARLKYTVGKIDASPVDEPTYTIDVTTQYQTMLGFGGAFTDAAAINLYKL
SPKLQNLAMDQYFSKKGLEYNMARVPIGSTDFSTRTYTYNEKVDDFKMTNFTIASDKAPF
SHKIDLIQRALKMTELKLFASSWAPPLWMTRGDSVVDCKMKGKPGEKYWAALALYYSKFF
DAYKEEGINFWAMTVQNEPEKPPLAVSQWETLRLTAEEERDFIKLDLGPLMAKKYPDLKI
MANDDQKPGIMDRSAPFDDPESKKYLSGLAFHWYQNLDFILPLAGNFKNLEKFHKAHPDM
FMLGTEACEGFLPGIIGTGKGPSLDDPKKAWKRAQNYARDIIENSNNMAAGWVDWNLFLD
TDGGPNWAKNMVDAPILVDEQNGAEFYKQPMFYIMGHFSKFVPPGSKRIEFPKTETLSDF
HRCAFVTPDNQIVMQFLNRDDDPVSISVKQTDSNTFSLTLPPNSMQTVILPASEDTKIL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctgtcccccgttgctatcttcgcatcgagtctgttgctcgccccgagtgcg
gtgtcggctgcatgctccagctggtcgtcactttaccaggatgtattggagggcgtctgt
gtctgtaacgcgactcaatgcgatacaattgtcggcgaccacacgaatctcgaggagggt
gagattggcatctacaccacggccaaggccggcgctcgcttaaagtacacggtggggaaa
atcgacgcatccccggtagacgaacccacctacaccatcgacgttaccacgcaataccag
accatgctcggcttcggtggagccttcacggatgcagcagccatcaacctatataaattg
tcacccaagctgcagaatttggccatggatcaatacttctccaagaagggccttgagtac
aatatggctcgtgtaccgatcggctcgaccgatttctctacgagaacctacacatacaac
gagaaggtggacgatttcaagatgaccaacttcactatcgcgtccgacaaggcaccattc
tcgcacaaaatcgacctgatccagcgtgctcttaaaatgactgagctaaagttattcgcg
tcgtcgtgggcacccccgctttggatgacgagaggagactcggtcgtagactgcaagatg
aaaggaaagcctggagagaagtactgggcggcactggcgctgtactattccaagttcttt
gacgcctacaaggaggaaggtatcaacttctgggctatgacagttcagaatgagcctgag
aaacctcctctcgctgtttcccagtgggaaacgctgcgcttgactgccgaggaagagaga
gattttattaaactggaccttggtccgttgatggcgaaaaagtaccccgacctaaagatt
atggccaacgatgaccagaagcctggtatcatggatcgctcagcgccgtttgatgacccg
gagtcgaagaaatacttgagtgggcttgccttccactggtaccagaatctcgactttatc
ttgccgctcgctggcaactttaagaatctggagaaattccacaaggctcatcccgacatg
ttcatgctcggaacggaagcgtgtgaaggattcttgcccggcatcatcggtaccggcaag
ggaccctctctggatgatccaaagaaggcgtggaagcgagctcagaactacgcacgtgac
atcattgagaacagcaacaacatggctgccggctgggtcgattggaacctgttcctggat
acggacggtggtccgaactgggcgaagaacatggtggatgcgccgattcttgtcgatgag
cagaatggcgccgaattctacaagcagcccatgttttacatcatgggccacttctcaaag
ttcgtaccgccgggatcgaagcgcatcgaatttccaaagaccgagacactgagcgacttc
caccgctgcgcttttgttacccccgacaaccaaattgtgatgcagttcttgaatcgcgac
gacgacccggtttcgataagcgtcaagcagacggactcgaacacgttctcgctgacgctg
ccgcccaattcgatgcagacagttatcctcccggcttccgaggataccaaaatcctgtag

DBGET integrated database retrieval system