KEGG   Phytophthora infestans: PITG_17508Help
Entry
PITG_17508        CDS       T01333                                 

Definition
glucosylceramidase, putative
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pif  Phytophthora infestans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PITG_17508
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PITG_17508
Enzymes [BR:pif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PITG_17508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 499 aa AA seqDB search
MIPFSQAIDCNNWSMRYKKFIDGVCVCNSTVACDTFPNDYVKLASGQAGVYRTTRDGERF
RYETATFVDGSSADADLIIDASTTYQTIIGFGGAFTDAAAINLYKMNDKIQNMILDAYYS
VDGIQYTTGRIPISSTDFSTSVYSYDATVDDFDMSDFSIAVDKSSATHKLDLIHRVLDTT
ERNLSIFASSWAPPVWMTKENTTLNCHMKGNPGEQYWKALALYYSKFITAYKNEGINIWA
MTTQNEPDEPLVKLNAWQSLRFTAATERDFIKKDLGPRMKADHPNLKLILMDDNKSHLLN
WLAALEDSEAAQYVAGVGIHWYSNVDFPLGIGGSFSDLTTFHTKYPNVFMIGTEACEGYI
PDWVVTSTGAGVKLGDFNIGWWRAHNYAKDIINDLTSYVSGWTDWNLILDTNGGPNWAKN
FVDAPIIVDETNGNEIYKQPMYYVMGHFSKFLTPGSVRLKFTAASGSKSRLSDVDWAAFL
TPENQYVAIMFNKGTADRL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgataccattttcccaagccatcgactgcaacaactggtcgatgcgatacaagaaattc
atcgatggtgtctgcgtctgcaatagcactgtagcctgcgatacattcccgaacgactat
gtgaagttggcatcgggccaggccggggtataccgcacaacgcgagacggcgagcgcttc
cgctacgagacagccacgttcgtcgacggctcctccgctgacgccgatctgatcatcgat
gcgagcaccacgtatcagaccatcatcggctttggtggcgccttcacggatgctgcagcc
atcaacttgtacaagatgaatgacaagatccagaacatgatcctcgacgcgtattactcg
gtggacggtattcagtacaccacgggtcgcatccccatttcatccaccgatttctccact
agcgtttactcgtacgacgccaccgtggacgacttcgatatgagtgacttttccatcgct
gtggacaagtcatcggctacgcacaagctggatctgatccaccgtgtgctggacacgaca
gagcgcaatctctctatcttcgcgtcatcctgggccccgccagtgtggatgacaaaggag
aatacgacgctcaattgccacatgaagggaaaccccggcgaacagtactggaaagcactg
gcactctactactccaagttcatcactgcgtataagaacgaagggatcaatatctgggcc
atgacgacgcagaatgaacccgatgagcctcttgttaagctgaacgcgtggcagagtctc
cgattcacagcagcgactgagcgtgactttatcaagaaagaccttggcccgcgaatgaaa
gccgatcatcccaatctgaagctcatactcatggacgacaacaagagtcacttgctcaac
tggttggcagctcttgaagacagtgaagcggctcaatacgtggctggtgtgggcattcac
tggtattccaacgtcgatttccctctgggtatcggtggcagctttagcgacctcactacc
tttcacaccaagtatccaaacgtgttcatgatcggaacagaagcttgcgagggctacatt
cccgactgggttgtcacgagcaccggtgcaggagtgaaactgggcgacttcaacatcggt
tggtggcgagcacacaactacgccaaggatatcatcaacgatctcaccagctatgtgtct
ggatggaccgactggaacctcatactcgatacgaacggaggacccaactgggctaagaac
ttcgtcgatgcgccgatcatcgtggatgaaaccaatggcaacgagatctacaagcagccc
atgtactacgtcatgggtcacttctccaagtttctgacccctggctctgtgcgtctcaaa
ttcacagcagcaagcggaagcaagtcacgacttagtgatgtggactgggcggccttcttg
actcccgaaaatcagtacgtggcgatcatgttcaacaagggaacagcggacagactgtga

DBGET integrated database retrieval system