KEGG   Phytophthora infestans: PITG_18083Help
Entry
PITG_18083        CDS       T01333                                 

Definition
alkaline phosphatase, putative
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pif  Phytophthora infestans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pif00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 510 aa AA seqDB search
MANLKRMLALCAAAVTLASAATRYEYKTVDVDYNFDENEDSPRSVIMMIPDGTGPNIFTL
ARTVLDPTLETRLHIDPHLMGTVQTHSSTSYITDSASSATAYSTGYKTYDSAIAVDTYEQ
PLGTVLEAAKARGMVTGMIVTCRVTHATPASFATHVIDRDSEDDIASQYVANKNLDFLLG
GGKKHFNETMLEDLKSNGYTLADNYQDLLDYQSANAETGALRLFGLFNDDHMLYEVDRLR
ELAENNSTTREPSLPEMVDVVLGLLRKNEQAKKHGYFVMIEGSRVDHAGHSNDPGTMAKE
AIAFDESVAVVLDHVEQTPNTAMLSAADHGTGGLTLGRGPAFPYAWYPTELQLQNMSTEA
MQEQLEVVLEGNDCASGANDTCKAALLTSSKHLLANYTNVTTVSDEEVVELVSQIATVVD
ETRDLNDVMIELGHVISLRAAIHWTTIGHVGTDVNLYCKGPLIFERMCKGVHENTYLNKM
MTTFLGLEHQQELETMKHRNISVLENPLAF
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggccaatctcaagcgcatgttggcgctgtgtgctgctgctgtcacgctagcaagcgct
gctactcgctacgaatataagactgtcgatgtggactacaacttcgacgagaacgaagac
tctccacgcagcgtcatcatgatgatcccggacggcactggtcccaacattttcacgctg
gcacgcacggtgcttgacccgactcttgagacccgcctacatattgaccctcacctcatg
ggaacggtgcagactcactcgtctacgagctatatcacggactccgcttcgtccgcgacg
gcctactcgactggttacaagacgtacgactcggctatcgctgttgacacgtacgagcag
cctttgggtaccgtactggaagccgctaaggctcgtggcatggtgacaggaatgatcgta
acgtgccgggtaacgcacgcgacacctgcatcatttgcgacccacgtgatcgaccgcgat
tccgaggacgacatcgcttcgcagtatgttgcgaacaagaaccttgacttcttgcttggc
ggtggcaagaaacactttaatgaaacgatgcttgaagacctgaagtcgaacggctacaca
ctggcggacaattatcaggacctgctcgactaccagtctgccaacgccgagacgggcgcc
cttcgcctgtttggtctgtttaacgatgaccacatgctgtacgaggttgaccgcttgcgt
gaacttgctgaaaataactccactacccgtgagcccagtctaccggagatggtggatgtt
gtgctaggtcttctacgcaagaacgagcaggctaagaaacacggctacttcgtgatgatc
gagggatctcgtgttgaccacgcaggtcactcaaatgatcctggtacaatggcgaaggag
gcgattgcttttgatgaatctgtcgctgtagtgctcgaccatgtggagcagacccccaac
acggcaatgctatccgctgctgatcacggtacgggcggtctcactcttggacgggggccc
gctttcccgtatgcctggtacccaaccgaactgcagctccagaacatgtcaacggaggcc
atgcaggaacagctcgaggtcgttctcgaaggaaacgactgtgcgagtggtgccaacgac
acgtgcaaagctgcgttgctcacctcgtccaaacatctcctagccaactacacgaacgta
acgacggtctcggacgaagaagtggttgagctggtctctcaaattgccacagttgtcgac
gaaacgcgcgacctgaatgacgttatgatcgagttgggccacgtgatcagtctgcgtgct
gctatccactggaccaccatcggccacgtaggcacggatgtgaacctatactgcaagggt
ccactcatctttgagcgcatgtgcaagggcgtccacgagaacacgtacttgaacaagatg
atgacgacgttcttgggtctggaacatcaacaggagctggagacgatgaagcatcgcaac
atttcggtgcttgaaaacccactcgctttttga

DBGET integrated database retrieval system