KEGG   Phytophthora infestans: PITG_18435Help
Entry
PITG_18435        CDS       T01333                                 

Definition
uricase, putative
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pif  Phytophthora infestans
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PITG_18435
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    PITG_18435
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     PITG_18435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 307 aa AA seqDB search
MAVKLVQHEHGKGRVRMLKVTRTPEKHMVIQLEAEVLLEGAPAASAYYEGDNGHVLPTDS
VKNTVWVLAKKHEFASLEDFGVILAQHFVTRHPDIISVAKVKLIETPWERVVVPDSKGKT
RPHHHAFVSASSGFSTAYVVARNSTHGAPEVTVQGGVDGLKVLKTTQSSFVDFFRDAYTT
LPDVPDRLVSTCVMATWNYTSDAIGGDFIARSAEIKNVLLATFAGPADVGVPSPAVQFTL
YKMGEAVLERCPYVKDIKITMPNIHNNPIDLSRFGCKNIHPHGEVFLPTDEPHGIISATV
VRSTSKL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaagctcgtgcagcacgagcacggcaagggccgcgtgcgcatgctcaaggtg
actcgcacgcccgagaagcacatggtgattcagctggaggcggaagtgctactggagggt
gcgcccgccgccagcgcctactacgagggcgacaatggtcacgtgctgcccacggactcg
gtcaagaatacggtgtgggtgttggcaaagaagcacgagttcgcatcgctagaggatttt
ggcgtcatcctagcgcagcacttcgtcaccaggcacccagacattatcagcgtggccaag
gtgaagctcatcgagacgccgtgggagcgcgtggtggtgcccgactcaaagggtaagaca
cgtccgcatcatcacgcctttgtcagtgccagttccggattctccaccgcctatgtggtg
gctcgcaactcgacgcatggcgccccggaagtgacggtgcaaggcggtgtggatggcctt
aaagtgctaaaaaccacgcagagttcttttgttgacttcttccgtgatgcgtacacgacg
ctgcctgacgtacccgaccgcctcgtcagcacgtgtgtcatggccacgtggaactacact
tccgatgccatcggcggagacttcatcgccagatctgcggagatcaagaacgtactactc
gcgaccttcgcaggcccagctgatgttggcgtgcccagtcctgctgtgcagtttacgctg
tacaaaatgggcgaggctgtgctggagagatgcccgtatgttaaggatatcaagatcacg
atgcccaacatccacaacaatcccattgacctgtctcgctttggctgcaagaacatccac
ccccacggcgaggtgttcctgccgacagacgagccacatggcatcatatcggccacggtg
gtgcgatcgacgtctaagctgtag

DBGET integrated database retrieval system