KEGG   Phytophthora infestans: PITG_18437Help
Entry
PITG_18437        CDS       T01333                                 

Definition
uricase, putative
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pif  Phytophthora infestans
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pif00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:pif00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 307 aa AA seqDB search
MVVKLVQHEHGKGRVRMLKVTRTPEKHSVIQLEAEVLLEGALAASAYYEGDNGHVLPTDS
VKNTVWVLAKKHEFASLEDFGVILAQHFVTRHPDIISVAKVKLIETPWERVVVPDSKGKT
RPHHHAFVSASSGFSTAYVVARNSTHGAPEVTVQGGVDGLKVLKTTQSSFVDFFRDAYTT
LPDVPARLVSTCVMATWNYTSDAIGGDFIARSAEIKNVLLATFAGPADVGVPSPAVQFTL
YKMGEAVLERCPYVKDIKITMPNIHNNPIDLSRFGCKNIHPHGEVFLPTDEPHGIISATV
VRSTSKL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcaagctcgtgcagcacgagcacggcaagggccgcgtgcgcatgctcaaggtg
actcgcacgcccgagaagcactcggtgattcagctggaggcggaagtgctactggagggt
gcgctcgccgccagcgcctactacgagggcgacaatggtcacgtgctgcccacggactcg
gtcaagaatacggtgtgggtgttggcaaagaagcacgagttcgcatcgctagaggatttt
ggcgtcatcctagcgcagcacttcgtcaccaggcacccagacattatcagcgtggccaag
gtgaagctcatcgagacgccgtgggagcgcgtggtggtgcccgactcaaagggtaagaca
cgtccgcatcatcacgcctttgtcagtgccagttccggattctccaccgcctatgtggtg
gctcgcaactcgacgcatggcgccccggaagtgacggtgcaaggcggtgtggatggcctt
aaagtgctaaaaaccacgcagagttcttttgttgacttctttcgtgatgcgtacacgacg
ctgcctgacgtacccgcccgcctcgtcagcacgtgtgtcatggccacgtggaactacact
tccgatgccatcggcggagacttcatcgccagatctgcggagatcaagaacgtactactc
gcgaccttcgcaggcccagctgatgttggcgtgcccagtcctgctgtgcagtttacgctg
tacaaaatgggcgaggctgtgctggagagatgcccgtatgttaaggatatcaagatcacg
atgcccaacatccacaacaatcccattgacctgtctcgctttggctgcaagaacatccac
ccccacggcgaggtgttcctgccgacagacgagccacatggcatcatatcggccacggtg
gtgcgatcgacgtctaagctgtag

DBGET integrated database retrieval system