KEGG   Phytophthora infestans: PITG_18501Help
Entry
PITG_18501        CDS       T01333                                 

Definition
catechol O-methyltransferase, putative
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
pif  Phytophthora infestans
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    PITG_18501
Enzymes [BR:pif01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     PITG_18501
Exosome [BR:pif04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PITG_18501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 272 aa AA seqDB search
MKFLKSLLDKKSHKGADRADNGAVVTRKLPPIDLTRTTRSITSADNGEKKPRIGKLTLSA
KCLEYVKQHAERGNPTSVINCIDKFASTNHVMNINQVKGAVVDEEIRKKKPVVMAKLGAY
TGFSTVRFASLQREVVGKESHYYSFEYSPVFAARVREMVEIAGLVNQMTVYVGAFSEQYQ
VLRGKTVDRSKSCTFIIDHEKTVYLSDLKLIIGSHTLAPGSVIAADNVVRPGAPDYLEFI
ENNPQFSTERHTISCGRDGLLLPDLSIATFLG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttctcaagtctctgctcgataagaagtctcacaaaggcgccgatcgtgcagat
aatggtgccgtggtgactagaaagctgcctcccatcgacttgacacggacgactcgttct
atcacgagcgctgacaacggggagaagaaacccagaatcgggaaactcacgctctcggcc
aagtgcctcgaatacgtcaaacaacacgcagagcgcggcaatccgacctccgtcatcaac
tgcatcgacaagttcgcgtccacgaaccacgtgatgaacattaaccaagtcaagggagca
gtggttgacgaggagatccgcaagaaaaagccagtcgtgatggcaaaactgggcgcttac
actggcttcagtaccgtgaggttcgcgagtctgcagcgcgaggtcgtcggcaaggagtcg
cattactactcgtttgaatactcgccagtattcgctgctcgcgttcgtgagatggtggag
attgcggggctagtgaatcaaatgacggtgtatgttggggcgttctccgagcagtatcaa
gtgctgcgtggcaagaccgtcgaccgcagtaagagctgcaccttcatcatcgaccacgag
aagacggtctatttgtccgatctgaagctgattatcggcagtcacacgttggctcccggc
tctgttatcgctgcagacaacgtcgtgcgacctggtgcgcccgactacctcgagtttatt
gagaacaaccctcaattctcgactgagcgtcacacaatcagctgtggacgtgacggcctt
ttgctgccggacctgtccatcgccacattcttgggataa

DBGET integrated database retrieval system