KEGG   Phytophthora infestans: PITG_19551Help
Entry
PITG_19551        CDS       T01333                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pif  Phytophthora infestans
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pif03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 264 aa AA seqDB search
MDSWDDDEFEVPSVTETQKVAANWDDEEEEEEPVVSAKPEPAVPKGPLKPKQLKKMKLKE
IEEKQKMEIALTKARLAAQADETDDQRRSREKASIEEADFEMAIDAFAGAPPKPAAGASD
DADNAISAMRLLSLADHEHLGDVVASRLATSNAKYALECIKVILTKASVNLTADDMKEIT
TIVNVIKNEKITAAKPKGKKKKQAGKQGYANVERSVGNGGAGGMGYAGFEDTYDDYDDFI
KKVNKVRLCLKQALSPPNSFGQTW
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggactcctgggatgacgacgaattcgaagtcccatcggtgacggagacgcaaaaggtc
gctgccaactgggacgacgaggaggaagaggaggagccggttgtgtctgccaagcccgag
ccggccgttcccaagggcccgctcaagcccaagcagctgaagaagatgaagctaaaggag
attgaggagaagcagaagatggaaatcgcccttaccaaggcacgtcttgccgcccaggct
gatgagaccgacgaccagcgtcgatcccgcgagaaggcctccatcgaggaggcagacttt
gagatggccattgacgcctttgccggtgccccgcccaagccggcggcgggtgcttccgac
gacgccgataatgctatctcagcaatgcgcttgctgtcactcgccgaccacgaacacctg
ggtgacgtggtggcgtctcggctggccacgtccaacgccaagtacgcgcttgagtgcatt
aaggtgatcctgacgaaggcatcggtgaacttgacagccgatgacatgaaggagatcaca
actatcgtcaacgttatcaagaacgagaaaatcaccgctgccaagcctaagggcaagaag
aagaagcaggcgggtaaacagggctacgctaacgtcgagcgcagcgtcggcaacggtggt
gccggaggaatggggtacgctggcttcgaagacacgtacgatgactacgatgactttata
aagaaggtgaacaaggtgcgcctgtgcctaaaacaagcgctttctccgcccaactctttt
gggcaaacatggtag

DBGET integrated database retrieval system