KEGG   Phytophthora infestans: PITG_20156Help
Entry
PITG_20156        CDS       T01333                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PITG_20156
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PITG_20156
Messenger RNA biogenesis [BR:pif03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PITG_20156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 353 aa AA seqDB search
MFRKKTAGPVVDEKGAPANAISPAAPVDAPRVRRAFCLGDFDLLATLGTGTFGRVRLVQL
KGVGSFHALKILKKSEILRLQQLHHIKCEVEILSRIQHPFIVNYLGHFQDERRLYLVLEY
VQGGELFSYLRRQGRFPDHVACYYAAQLVTALACLHAQHIIYRDLKPENLLITSEGYLKI
TDFGFAKIVEDKTWTLCGTPEYLAPEIIQSKGHGKSVDWWALGVLIYEMLAGYPPFYDEN
PFGIYQKILDGKVDFPKHIDSKAKDLIKKLLSQDRTKRLGCLRGGSEDVKKHKYFGKVDW
NSVLARSETPPYLPPVGGPGDHTHFDEYPDSPVDDAVILYGEDRAAFEVFDQF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcaagaagacggccggtccggtagtcgacgagaagggggcccccgccaacgcc
atctcccctgctgcacccgtagatgccccgcgcgtacgacgagccttctgtttgggtgat
tttgatctcctggcaactttgggtacgggcacttttggccgcgtacgcctagtgcaactg
aaaggcgtggggtctttccacgcactgaagatcctcaagaagagcgagatcttgcggctg
caacagctgcaccacatcaagtgcgaagtggagatcttgagcagaattcaacacccgttt
atcgtcaactacctgggtcatttccaggacgaacgaagattgtatcttgttctcgaatat
gtgcaaggtggcgagctcttttcctatttgcgacgccaaggccgtttccccgaccatgtg
gcctgctactacgcagcgcaattggtcacagcactggcttgtctccatgcgcaacacatt
atctacagagacttaaagcccgagaacctccttatcacatccgaaggatacctcaagatc
accgactttggctttgccaagatcgttgaggacaagacgtggacactatgcggtacaccc
gagtacctcgctccggagattattcagagtaaaggtcacggcaagtcggtggattggtgg
gcgctcggcgtgcttatctacgagatgctggccgggtatccgcccttctacgacgagaac
ccgttcggtatttatcaaaagatcctggacggcaaggtggacttccccaagcacatagac
tccaaggccaaggacctcattaagaagctcttatcgcaagaccgtaccaagcgactcggc
tgcttacgaggcggatcggaagacgtgaagaaacataaatatttcggcaaagtggactgg
aattcggtgctcgcacgctccgagacgccgccatatctaccgccagtgggaggacccggc
gaccatacgcatttcgacgagtacccggactcgcccgttgacgacgctgtcattctgtat
ggagaagatcgagctgccttcgaagtgttcgaccaattttaa

DBGET integrated database retrieval system