KEGG   Phytophthora infestans: PITG_20197Help
Entry
PITG_20197        CDS       T01333                                 

Definition
histone acetyltransferase, putative
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PITG_20197
Transcription machinery [BR:pif03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PITG_20197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 598 aa AA seqDB search
MASETADKDASPAVASTSKDEIVGASEKSSQNTEDSIKNSQGNEDADTGETKQQDEPAAA
NDVEMKEADEGKDEEVNPTTTVEEDVDMVEAKDETEENAADDDKAASKNLSGELRTEENE
AKTEDEEPSTVKAKEAAADAEAAESGDVDMKAAEAEAKSENNDENASPSKTQASVQADNT
PQQSTQDDTEMKNSSESSSPKHKEQVQSSPSKTSNGVNGLAEPAAKKQRTSPKTPEDATP
AKEAGSSSLILSRDDMAKMEEDSGRLKFDVITNDGTDEHMIQLTTLKNIFAKQLPKMPKE
YIVRLVFDKNHRSMLLLKNGTHVIGGICYRPFEKNQFAEIAFCAINASDQVKGYGTRLMN
HLKEYVKTKNITHFLTYADNYAIGYFKKQGFTKSVSMARPNWYGYIKDYDGGTLMECTIH
TQINYLRITSMIHQQRNAILDKIQERSRAKTVYDGLTTFAEGRLMDIYMVPGVKEAGWSQ
ATIRNNRIGTRDQGSLKAQLSQLLKAVSNHRSAWPFHEPVDTSVVVDYLDHIKEPIDLQL
ISKRIDSGAYISKAAFKVDLEKMCDNCMLYNTPDTNYYKAAIDLKEFIQSRIQIRDLK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggagacagcggacaaggacgcgtcgcccgctgtggcgtctacatctaaagac
gagatcgtcggtgcgagcgaaaaatcgagtcaaaacacggaggattcaattaagaactct
caaggcaacgaagatgccgataccggggagactaagcaacaggatgagcctgcagctgcc
aacgacgtggagatgaaggaagctgatgagggaaaggacgaggaggtgaatcccactact
acggtagaagaagacgtagatatggtggaggcaaaggacgagacggaagagaacgctgct
gacgacgacaaagcagcgtctaagaacttgtcaggtgaattgcgtacggaggagaatgag
gcaaagacggaagatgaagagcctagcactgttaaagcgaaggaggctgccgcagatgcg
gaggctgctgagagtggtgatgtggacatgaaggcggctgaagcggaagcgaagagtgaa
aacaacgatgaaaatgcgtctccttccaagacgcaggcatccgttcaagctgacaatacg
ccgcagcagtcgacacaagatgatactgagatgaagaattctagtgaatcgtcgagtccg
aagcataaggaacaggtgcagtcatctccatctaaaactagcaacggagtgaacgggtta
gcggaacctgctgctaagaagcaaagaacgagtccaaaaactcctgaagatgccactcca
gctaaggaagccggatcgtcgtctctgattctctcacgtgacgatatggcaaagatggag
gaggacagcggtcgactgaagtttgatgtgatcacaaacgatggtactgacgaacatatg
atccagctcacgactctgaagaatatctttgcgaaacaactgccaaagatgccgaaggag
tatattgtacgcctggttttcgataagaaccaccgctccatgctccttctcaagaatggt
acccacgttattggcggtatctgttaccgaccgttcgagaagaaccaattcgcagagatt
gcgttctgtgccatcaatgcctcggaccaggtgaaaggatacggcacgcggctgatgaac
cacttgaaggaatacgtcaagaccaagaacatcacgcacttccttacgtacgccgacaac
tacgctattggatatttcaagaagcaaggcttcacgaagagtgtgtcgatggctcggccg
aactggtatggctacatcaaggattacgacggtgggacgctgatggagtgcacaattcac
acccagatcaactatttaaggatcacgtcaatgattcatcagcagcgcaatgcaatccta
gacaagatccaggagcgatctcgtgcaaagacagtgtacgatggtctgacaacctttgca
gagggaaggctgatggacatttacatggttcctggcgtcaaggaagctggctggtcacag
gctacaatccgcaataaccgtatcggaactcgcgatcaaggcagcttaaaggcacagctc
tcacagctgctcaaggcagtgtccaaccatcggagtgcatggccattccatgagcccgtg
gacaccagtgtcgtggttgactaccttgaccacattaaggaacccatagacctccaacta
atcagcaagcgcatcgacagtggagcctatatttccaaggctgcgttcaaagtagaccta
gagaagatgtgcgacaactgcatgctctacaatacgccggacaccaactactacaaggcc
gctatcgacctcaaagagttcattcagtctcgaattcagattagggatctcaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system